CoraLite®594-conjugated COPE Monoclonal antibody

• 

  WB analysis using CL594-66994

  HeLa cells were subjected to SDS PAGE followed by western blot with CL594-66994 (COPE antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

COPE Monoclonal Antibody for WB

Cat No. CL594-66994

Clone No.2B8E8

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB

Synonyms

Coatomer subunit epsilon, COPE, Epsilon coat protein, epsilon COP, FLJ13241

---

Tested Applications

• Positive WB detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66994 targets COPE in WB applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28602

  Product name: Recombinant human COPE protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-308 aa of BC017285

  Sequence: MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVLDEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFLLMAASIYLHDQNPDAALRALHQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDATLTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDRLVLQYAPSA

• Full Name: coatomer protein complex, subunit epsilon
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC017285
• Gene Symbol: COPE
• Gene ID (NCBI): 11316
• RRID: AB_2934754
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O14579
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.