COX6C Recombinant monoclonal antibody, PBS Only (Capture)

COX6C Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 86818-2-PBS
Clone No.251865D9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

COX6C Recombinant monoclonal antibody, COX6C Recombinant monoclonal antibody, PBS Only (Capture)

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86818-2-PBS targets COX6C as part of a matched antibody pair:

MP02689-1: 86818-2-PBS capture and 86818-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1982

Product name: Recombinant human COX6C protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-75 aa of BC000187

Sequence: MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK

Predict reactive species
Full Name cytochrome c oxidase subunit VIc
Calculated Molecular Weight 75 aa, 9 kDa
Observed Molecular Weight9 kDa
GenBank Accession NumberBC000187
Gene Symbol COX6C
Gene ID (NCBI) 1345
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP09669
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Cytochrome c oxidase (COX) is the terminal oxidase in the respiratory chain in human and other mammalian cells. The enzyme is composed of 13 different subunits. COX6C(Cytochrome c oxidase subunit 6C) is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

Loading...
||
New chat

Able

正在加载,请稍候...