COX7B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• COX7B Polyclonal antibody, PBS Only (11417-2-PBS)

• 

  WB analysis using 11417-2-AP (same clone as 11417-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11417-2-AP (COX7B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11417-2-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 11417-2-AP (same clone as 11417-2-PBS)

  WB result of COX7B antibody (11417-2-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-COX7B transfected MCF-7 cells. This data was developed using the same antibody clone with 11417-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 11417-2-AP (same clone as 11417-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 11417-2-AP (COX7B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11417-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 11417-2-AP (same clone as 11417-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 11417-2-AP (COX7B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11417-2-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

COX7B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11417-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

11417-2-PBS targets COX7B in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1988

  Product name: Recombinant human COX7B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-80 aa of BC018386

  Sequence: MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVGRVTPKEWRNQ

• Full Name: cytochrome c oxidase subunit VIIb
• Calculated Molecular Weight: 80 aa, 9 kDa
• Observed Molecular Weight: 9 kDa
• GenBank Accession Number: BC018386
• Gene Symbol: COX7B
• Gene ID (NCBI): 1349
• RRID: AB_2085709
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P24311
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

COX7B, also named as Cytochrome c oxidase subunit 7B, mitochondrial, is a 80 amino acid protein, which belongs to the cytochrome c oxidase VIIb family. COX7B protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX7B plays a role in proper central nervous system development in vertebrates. COX7B as a terminal enzyme in the mitochondrial respiratory chain (oxidative phosphorylation OXPHOS), catalyzing the electron transfer from reduced cytochrome c to molecule oxygen and plays a role in eye development.