CPLX3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CPLX3 Polyclonal antibody, PBS Only (16949-1-PBS)

• 

  WB analysis using 16949-1-AP (same clone as 16949-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 16949-1-AP (CPLX3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16949-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 16949-1-AP (same clone as 16949-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 16949-1-AP (CPLX3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16949-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 16949-1-AP (same clone as 16949-1-PBS)

  IP result of anti-CPLX3 (IP:16949-1-AP, 3ug; Detection:16949-1-AP 1:300) with mouse brain tissue lysate 6000ug. This data was developed using the same antibody clone with 16949-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat eye using 16949-1-AP (same clone as 16949-1-PBS)

  Immunofluorescent analysis of (-20°C Acetone) fixed paraffin-embedded rat eye tissue using CPLX3 antibody (16949-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16949-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat eye using 16949-1-AP (same clone as 16949-1-PBS)

  Immunofluorescent analysis of (-20°C Acetone) fixed paraffin-embedded rat eye tissue using CPLX3 antibody (16949-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16949-1-PBS in a different storage buffer formulation.

CPLX3 Polyclonal Antibody for WB, IF-P, IP, Indirect ELISA

Cat No. 16949-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, IP, Indirect ELISA

Synonyms

complexin 3, Complexin III, Complexin-3, CPX III, CPXIII

---

Product Information

16949-1-PBS targets CPLX3 in WB, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10571

  Product name: Recombinant human CPLX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-158 aa of BC018026

  Sequence: MAFMVKTMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDAQFTQRKAERATLRSHFRDKYRLPKNETDESQIQMAGGDVELPRELAKMIEEDTEEEEEKASVLGQLASLPGLNLGSLKDKAQATLGDLKQSAEKCHVM

• Full Name: complexin 3
• Calculated Molecular Weight: 158 aa, 18 kDa
• Observed Molecular Weight: 20-23 kDa
• GenBank Accession Number: BC018026
• Gene Symbol: CPLX3
• Gene ID (NCBI): 594855
• RRID: AB_2084042
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WVH0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CPLX3, also named as Complexin-3, is 158 amino acid protein, which belongs to the complexin/synaphin family. CPLX3 localizes in the membrane and binds to the SNARE core complex containing SNAP25, VAMP2 and STX1A. CPLX3 positively regulates a late step in synaptic vesicle exocytosis.