CPT2 Recombinant monoclonal antibody, PBS Only

CPT2 Uni-rAb® Recombinant Antibody for WB, IHC, Indirect ELISA
Cat No. 85013-4-PBS
Clone No.242381C5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

242381C5, Carnitine O-palmitoyltransferase 2, mitochondrial, carnitine palmitoyltransferase 2, CPT II, CPTASE

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85013-4-PBS targets CPT2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag24897

Product name: Recombinant human CPT2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 32-178 aa of BC002445

Sequence: GQYLQRSIVPTMHYQDSLPRLPIPKLEDTIRRYLSAQKPLLNDGQFRKTEQFCKSFENGIGKELHEQLVALDKQNKHTSYILGPWFDMYLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHL

Predict reactive species
Full Name carnitine palmitoyltransferase 2
Calculated Molecular Weight 74 kDa
Observed Molecular Weight 65-70 kDa
GenBank Accession NumberBC002445
Gene Symbol CPT2
Gene ID (NCBI) 1376
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP23786
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Carnitine palmitoyltransferase-1 and -2 (CPT1 and CPT2) are two genetically distinct mitochondrial membrane bound enzymes and play critical role in the regulation of FAO in normal cells. CPT2 is an ubiquitous protein and locates in the inner membrane of mitochondrial (PMID: 29437870). CPT2 is frequently down-regulated in primary ovarian serous carcinomas, which is significantly correlated with poor survival of ovarian cancer patients (PMID: 33486313). Down-regulation of CPT2 was a major cause of acylcarnitine accumulation and a common feature in mouse models of obesity- and NASH-driven HCC and human SH-HCC (PMID: 29872321).

Loading...
||
New chat Able
正在加载,请稍候...