CPT2 Recombinant monoclonal antibody

CPT2 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 85013-4-RR
Clone No.242381C5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

242381C5, Carnitine O-palmitoyltransferase 2, mitochondrial, carnitine palmitoyltransferase 2, CPT II, CPTASE

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, MCF-7 cells, HepG2 cells, T-47D cells, LNCaP cells, mouse liver tissue, rat liver tissue
Positive IHC detected inmouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85013-4-RR targets CPT2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag24897

Product name: Recombinant human CPT2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 32-178 aa of BC002445

Sequence: GQYLQRSIVPTMHYQDSLPRLPIPKLEDTIRRYLSAQKPLLNDGQFRKTEQFCKSFENGIGKELHEQLVALDKQNKHTSYILGPWFDMYLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHL

Predict reactive species
Full Name carnitine palmitoyltransferase 2
Calculated Molecular Weight 74 kDa
Observed Molecular Weight 65-70 kDa
GenBank Accession NumberBC002445
Gene Symbol CPT2
Gene ID (NCBI) 1376
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP23786
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Carnitine palmitoyltransferase-1 and -2 (CPT1 and CPT2) are two genetically distinct mitochondrial membrane bound enzymes and play critical role in the regulation of FAO in normal cells. CPT2 is an ubiquitous protein and locates in the inner membrane of mitochondrial (PMID: 29437870). CPT2 is frequently down-regulated in primary ovarian serous carcinomas, which is significantly correlated with poor survival of ovarian cancer patients (PMID: 33486313). Down-regulation of CPT2 was a major cause of acylcarnitine accumulation and a common feature in mouse models of obesity- and NASH-driven HCC and human SH-HCC (PMID: 29872321).

Protocols

Product Specific Protocols
IHC protocol for CPT2 antibody 85013-4-RRDownload protocol
WB protocol for CPT2 antibody 85013-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...