CPTP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CPTP Polyclonal antibody, PBS Only (33114-1-PBS)

• 

  WB analysis using 33114-1-AP (same clone as 33114-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33114-1-AP (CPTP antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33114-1-PBS in a different storage buffer formulation.

CPTP Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33114-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Ceramide-1-phosphate transfer protein, GLTP domain-containing protein 1, GLTPD1, Glycolipid transfer protein domain-containing protein 1

---

Product Information

33114-1-PBS targets CPTP in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35748

  Product name: Recombinant human GLTPD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-214 aa of NM_001029885

  Sequence: MDDSETGFNLKVVLVSFKQCLDEKEEVLLDPYIASWKGLVRFLNSLGTIFSFISKDVVSKLRIMERLRGGPQSEHYRSLQAMVAHELSNRLVDLERRSHHPESGCRTVLRLHRALHWLQLFLEGLRTSPEDARTSALCADSYNASLAAYHPWVVRRAVTVAFCTLPTREVFLEAMNVGPPEQAVQMLGEALPFIQRVYNVSQKLYAEHSLLDLP

• Full Name: glycolipid transfer protein domain containing 1
• Calculated Molecular Weight: 24 kDa，214aa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: NM_001029885
• Gene Symbol: GLTPD1
• Gene ID (NCBI): 80772
• RRID: AB_3742861
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5TA50
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ceramide-1-phosphate transfer protein (CPTP) is a member of the glycolipid transfer protein (GLTP) family. It is the only identified protein in mammals that can selectively transport ceramide-1-phosphate (C1P) through a non-vesicular mechanism (PMID: 35982909). CPTP plays a crucial role in various biological processes, including cell proliferation, migration, and invasion. It is involved in the regulation of lipid metabolism, particularly in the context of ceramide-1-phosphate, which is a bioactive sphingolipid with roles in cell signaling, inflammation, and autophagy (PMID: 29164996).