Tested Applications
| Positive WB detected in | T-47D cells, HEK-293 cells, MCF-7 cells, pig skin tissue, rat skin tissue |
| Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human skin cancer tissue |
| Positive IF/ICC detected in | MCF-7 cells |
| Positive FC (Intra) detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2500-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66468-1-Ig targets CRABP2 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0309 Product name: Recombinant human CRABP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-138 aa of BC001109 Sequence: MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE Predict reactive species |
| Full Name | cellular retinoic acid binding protein 2 |
| Calculated Molecular Weight | 16 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC001109 |
| Gene Symbol | CRABP2 |
| Gene ID (NCBI) | 1382 |
| RRID | AB_2881836 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P29373 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cellular retinoic acid binding protein 2 (CRABP2, synonyms: RBP6, CRABP-II). A number of specific carrier proteins for members of the vitamin A family have been discovered. Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown. CRABP2 is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptionally regulated by a newly synthesized regulatory protein.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CRABP2 antibody 66468-1-Ig | Download protocol |
| IF protocol for CRABP2 antibody 66468-1-Ig | Download protocol |
| IHC protocol for CRABP2 antibody 66468-1-Ig | Download protocol |
| WB protocol for CRABP2 antibody 66468-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
CRABP2 Antibody (Cat# 66468-1-Ig) has 4 total citations published in Cell Death & Disease, NPJ Precision Oncology, Cell Signaling, and PLoS One. Research fields include gastric cancer oxaliplatin resistance via mitochondrial apoptosis, anaplastic thyroid cancer drug sensitivity, colorectal cancer peritoneal metastasis through EMT signaling, and limbal stromal cell migration. Applications span WB, IHC, and IF in human and mouse species.
| Species | Application | Title |
|---|---|---|
Cell Death Dis Upregulation of CRABP2 by TET1-mediated DNA hydroxymethylation attenuates mitochondrial apoptosis and promotes oxaliplatin resistance in gastric cancer | ||
NPJ Precis Oncol ZEB1 and ALKBH5 coregulate CRABP2 and FABP5 and jointly determine the sensitivity of anaplastic thyroid cancers to gemcitabine and retinoic acid. | ||
Cell Signal CRABP2 promotes peritoneal metastasis in CRC through TGF-β/Smad-mediated EMT signaling and invadopodia formation | ||
PLoS One Increased sensitivity of primary aniridia limbal stromal cells to travoprost, leading to elevated migration and MMP-9 protein levels, in vitro |
Reviews
What customers say
One reviewer (Linyi Zhu, 2019) rated this antibody 4/5 stars. They used it at a 1:1000 dilution for Western Blot on porcine chondrocyte lysate and reported successful results. The review included an image demonstrating the antibody's performance in detecting CRABP2 in pig chondrocytes.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Linyi (Verified Customer) (01-17-2019) | We use this antibody on porcine chondrocytes lysate, 1/1000 dilution.
 |
