CREB3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CREB3 Polyclonal antibody, PBS Only (11275-1-PBS)

• 

  WB analysis of Jurkat using 11275-1-AP (same clone as 11275-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 11275-1-AP (CREB3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11275-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 11275-1-AP (same clone as 11275-1-PBS)

  WB result of CREB3 antibody (11275-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-CREB3 transfected HeLa cells. This data was developed using the same antibody clone with 11275-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 11275-1-AP (same clone as 11275-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 11275-1-AP (CREB3 antibody) at dilution of 1:50 (under 25x lens). This data was developed using the same antibody clone with 11275-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 11275-1-AP (same clone as 11275-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using CREB3 antibody (11275-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11275-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CREB3 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 11275-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

11275-1-PBS targets CREB3 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1823

  Product name: Recombinant human CREB3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-371 aa of BC009402

  Sequence: MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAIYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG

• Full Name: cAMP responsive element binding protein 3
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 40-64 kDa
• GenBank Accession Number: BC009402
• Gene Symbol: CREB3
• Gene ID (NCBI): 10488
• RRID: AB_10640533
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43889
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CREB3, also named as LZIP and Luman, belongs to the bZIP family and ATF subfamily. It is a transcription factors activated upon intramembrane proteolysis (RIP), binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AG][AG]-3'), a sequence present in many viral and cellular promoters. CREB3 binds to and requires HCFC1 as a coactivator. The activity and expression are suppressed when the HCFC1-CREB3 complex binds with CREBZF. Participates in LKN-1/CCL15-induced chemotaxis signaling. CREB3 is N-glycosylated and released by proteolysis. So the MW of CREB3 emirate 40kd to 64kd (PMID: 12138176).