CREB3 Monoclonal antibody

• 

  WB analysis of T-47D using 68379-1-Ig

  T-47D cells were subjected to SDS PAGE followed by western blot with 68379-1-Ig (CREB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HCT 116 using 68379-1-Ig

  HCT 116 cells were subjected to SDS PAGE followed by western blot with 68379-1-Ig (CREB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 68379-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68379-1-Ig (CREB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of U2OS using 68379-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using CREB3 antibody (68379-1-Ig, Clone: 1C12H11 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

CREB3 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 68379-1-Ig

Clone No.1C12H11

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

Human and More (1)

Applications

WB, IF/ICC, ELISA

Synonyms

CREB 3, CREB3, LUMAN, LZIP

---

Tested Applications

• Positive WB detected in: HEK-293 cells, T-47D cells, HCT 116 cells, hTERT-RPE1 cells
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

68379-1-Ig targets CREB3 in WB, IF/ICC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1823

  Product name: Recombinant human CREB3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-371 aa of BC009402

  Sequence: MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAIYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG

• Full Name: cAMP responsive element binding protein 3
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 40-64 kDa
• GenBank Accession Number: BC009402
• Gene Symbol: CREB3
• Gene ID (NCBI): 10488
• RRID: AB_3085097
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O43889
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CREB3, also named as LZIP and Luman, belongs to the bZIP family and ATF subfamily. It is a transcription factors activated upon intramembrane proteolysis (RIP), binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AG][AG]-3'), a sequence present in many viral and cellular promoters. CREB3 binds to and requires HCFC1 as a coactivator. The activity and expression are suppressed when the HCFC1-CREB3 complex binds with CREBZF. Participates in LKN-1/CCL15-induced chemotaxis signaling. CREB3 is N-glycosylated and released by proteolysis. So the MW of CREB3 emirate 40kd to 64kd (PMID: 12138176).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Biochem Biophys; Characterization of Novel Decenoic Acid Derivatives Exhibiting Cytotoxic Activity Against T98G Glioma Cells Under a Serum- and Glucose-deprived Condition.; Authors - Yuma Ito