CREB3 Monoclonal antibody, PBS Only (Detector)

CREB3 Monoclonal Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 68379-1-PBS
Clone No.1C12H11

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

Leucine zipper protein, Cyclic AMP-responsive element-binding protein 3, CREB-3, CREB 3, cAMP-responsive element-binding protein 3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68379-1-PBS targets CREB3 as part of a matched antibody pair:

MP50828-4: 68379-7-PBS capture and 68379-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1823

Product name: Recombinant human CREB3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-371 aa of BC009402

Sequence: MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAIYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG

Predict reactive species
Full Name cAMP responsive element binding protein 3
Calculated Molecular Weight 44 kDa
Observed Molecular Weight 40-64 kDa
GenBank Accession NumberBC009402
Gene Symbol CREB3
Gene ID (NCBI) 10488
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO43889
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CREB3, also named as LZIP and Luman, belongs to the bZIP family and ATF subfamily. It is a transcription factors activated upon intramembrane proteolysis (RIP), binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AG][AG]-3'), a sequence present in many viral and cellular promoters. CREB3 binds to and requires HCFC1 as a coactivator. The activity and expression are suppressed when the HCFC1-CREB3 complex binds with CREBZF. Participates in LKN-1/CCL15-induced chemotaxis signaling. CREB3 is N-glycosylated and released by proteolysis. So the MW of CREB3 emirate 40kd to 64kd (PMID: 12138176).

Loading...
||
New chat

Able

正在加载,请稍候...