CREB3 Monoclonal antibody, PBS Only (Detector)

• 

  WB analysis of T-47D using 68379-1-Ig (same clone as 68379-1-PBS)

  T-47D cells were subjected to SDS PAGE followed by western blot with 68379-1-Ig (CREB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68379-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HCT 116 using 68379-1-Ig (same clone as 68379-1-PBS)

  HCT 116 cells were subjected to SDS PAGE followed by western blot with 68379-1-Ig (CREB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68379-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68379-1-Ig (same clone as 68379-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68379-1-Ig (CREB3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68379-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 68379-1-Ig (same clone as 68379-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using CREB3 antibody (68379-1-Ig, Clone: 1C12H11 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68379-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP50828-4

  Cytometric bead array standard curve of MP50828-4, CREB3 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68379-7-PBS. Detection antibody: 68379-1-PBS. Standard:Ag1823. Range: 1.563-100 ng/mL.

CREB3 Monoclonal Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 68379-1-PBS

Clone No.1C12H11

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

Leucine zipper protein, Cyclic AMP-responsive element-binding protein 3, CREB-3, CREB 3, cAMP-responsive element-binding protein 3

---

Product Information

68379-1-PBS targets CREB3 as part of a matched antibody pair:

MP50828-4: 68379-7-PBS capture and 68379-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1823

  Product name: Recombinant human CREB3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-371 aa of BC009402

  Sequence: MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAIYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG

• Full Name: cAMP responsive element binding protein 3
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 40-64 kDa
• GenBank Accession Number: BC009402
• Gene Symbol: CREB3
• Gene ID (NCBI): 10488
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O43889
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CREB3, also named as LZIP and Luman, belongs to the bZIP family and ATF subfamily. It is a transcription factors activated upon intramembrane proteolysis (RIP), binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AG][AG]-3'), a sequence present in many viral and cellular promoters. CREB3 binds to and requires HCFC1 as a coactivator. The activity and expression are suppressed when the HCFC1-CREB3 complex binds with CREBZF. Participates in LKN-1/CCL15-induced chemotaxis signaling. CREB3 is N-glycosylated and released by proteolysis. So the MW of CREB3 emirate 40kd to 64kd (PMID: 12138176).