CREG2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CREG2 Polyclonal antibody, PBS Only (28236-1-PBS)

• 

  IHC staining of mouse brain using 28236-1-AP (same clone as 28236-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28236-1-AP (CREG2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28236-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 28236-1-AP (same clone as 28236-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28236-1-AP (CREG2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28236-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 28236-1-AP (same clone as 28236-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using CREG2 antibody (28236-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 28236-1-PBS in a different storage buffer formulation.

CREG2 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 28236-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

Protein CREG2

---

Product Information

28236-1-PBS targets CREG2 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28242

  Product name: Recombinant human CREG2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 42-215 aa of BC032949

  Sequence: VTNEVDEELDSASTEEAMPALLEDSGSIWQQSFPASAHKEDAHLRPRAGAARARQPPAPPGMFSYRREGGQTASAPPGPRLRAATARSLAHASVWGCLATVSTHKKIQGLPFGNCLPVSDGPFNNSTGIPFFYMTAKDPVVADLMKNPMASLMLPESEGEFCRKNIVDPEDPRC

• Full Name: cellular repressor of E1A-stimulated genes 2
• Calculated Molecular Weight: 32 kDa
• GenBank Accession Number: BC032949
• Gene Symbol: CREG2
• Gene ID (NCBI): 200407
• RRID: AB_3742288
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IUH2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The cellular repressor of E1A-stimulated genes (CREG) is a secreted glycoprotein that promotes the differentiation of pluripotent stem cells. CREG2 is a promising biological indicator because it plays an important role in increasing the migratory and proliferative capacity of lung adenocarcinoma (LUAD) cells (PMID: 40676398).