Biotin-conjugated CRK Monoclonal antibody

• 

  ELISA experiment of Ag28793 using Biotin-67035

  Biotin-67035 tested by ELISA. Ag28793(CRK 41-304 aa)was coated onto microtiter plates at 0.15 µg/well and then incubated with a dilution series of Biotin-67035 (start dilution 1:500. Bound antibodies were detected with Streptavidin Poly-HRP(1:5000)followed by incubation with HRP Substrate,terminated with 2M H2SO4,then measuring the resulting absorbance at 450 nm.

CRK Monoclonal Antibody for ELISA

Cat No. Biotin-67035

Clone No.2B7E1

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

ELISA

Synonyms

Adapter molecule crk, CRK, CRKII, p38, Proto oncogene c Crk

---

Tested Applications

• Positive ELISA detected in: Ag28793

Recommended dilution

• Enzyme-linked Immunosorbent Assay (ELISA): ELISA : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-67035 targets CRK in ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28793

  Product name: Recombinant human CRK protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 41-304 aa of BC008506

  Sequence: STSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPDEDFS

• Full Name: v-crk sarcoma virus CT10 oncogene homolog (avian)
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC008506
• Gene Symbol: CRK
• Gene ID (NCBI): 1398
• RRID: AB_3083813
• Conjugate: Biotin
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P46108
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CRK is a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. CRK has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytoplasmic proteins in the vicinity of tyrosine kinase through SH2-phosphotyrosine interaction. The N-terminal SH2 domain of this protein functions as a positive regulator of transformation whereas the C-terminal SH3 domain functions as a negative regulator of transformation.