CRTAC1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CRTAC1 Polyclonal antibody, PBS Only (30251-1-PBS)

• 

  WB analysis using 30251-1-AP (same clone as 30251-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30251-1-AP (CRTAC1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30251-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 30251-1-AP (same clone as 30251-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30251-1-AP (CRTAC1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30251-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HCT 116 using 30251-1-AP (same clone as 30251-1-PBS)

  WB result of CRTAC1 antibody (30251-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-CRTAC1 transfected HCT 116 cells. This data was developed using the same antibody clone with 30251-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 30251-1-AP (same clone as 30251-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 30251-1-AP (CRTAC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30251-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 30251-1-AP (same clone as 30251-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 30251-1-AP (CRTAC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30251-1-PBS in a different storage buffer formulation.

CRTAC1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30251-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

68 kDa chondrocyte-expressed protein, ASPIC, ASPIC1, Cartilage acidic protein 1, CEP 68

---

Product Information

30251-1-PBS targets CRTAC1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32963

  Product name: Recombinant human CRTAC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 198-332 aa of BC034245

  Sequence: VVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAP

• Full Name: cartilage acidic protein 1
• Calculated Molecular Weight: 661 aa, 71 kDa
• Observed Molecular Weight: 71-100 kDa
• GenBank Accession Number: BC034245
• Gene Symbol: CRTAC1
• Gene ID (NCBI): 55118
• RRID: AB_3086281
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQ79
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CRTAC1 (Cartilage acidic protein 1) is also named as ASPIC and 68 kDa chondrocyte-expressed protein (CEP-68). Cartilage acidic protein 1 (CRTAC1), a novel human marker which allowed discrimination of human chondrocytes from osteoblasts and mesenchymal stem cells (PMID: 17074475). CRTAC1 is a glycosylated calcium-binding extracellular matrix protein (PMID: 37796703). CRTAC1 acquired an alternate last exon from the tail-to-tail oriented neighbouring gene in humans resulting in the glycosylated isoform CRTAC1-A which represents a new extracellular matrix molecule of articular cartilage (PMID: 17074475). CRTAC1 was downregulated in bladder cancer tissues and cells (PMID: 34818994).