CoraLite® Plus 488-conjugated CRTAC1 Monoclonal antibody

CRTAC1 Monoclonal Antibody for IF/ICC
Cat No. CL488-68276
Clone No.2A11E2

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig, rabbit

Applications

IF/ICC

2A11E2, 68 kDa chondrocyte-expressed protein, ASPIC, ASPIC1, Cartilage acidic protein 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68276 targets CRTAC1 in IF/ICC applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag32813

Product name: Recombinant human CRTAC1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 99-451 aa of BC034245

Sequence: VYGNWNGPHRLYLQMSTHGKVRFRDIASPKFSMPSPVRTVITADFDNDQELEIFFNNIAYRSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAPLECGQGFSQQENGHCMDTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKKCSRGYEPNEDGTACVGTLGQSPGPRPTTPTAAAATAAAAAAAGAATAAPVLVDGDLNLGSVVKESCEPSC

Predict reactive species
Full Name cartilage acidic protein 1
Calculated Molecular Weight 661 aa, 71 kDa
Observed Molecular Weight 71 kDa
GenBank Accession NumberBC034245
Gene Symbol CRTAC1
Gene ID (NCBI) 55118
RRIDAB_3672987
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NQ79
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CRTAC1 (cartilage acidic protein 1) is also named as ASPIC1 and CEP68. CRTAC1 is an extracellular matrix protein of human chondrogenic tissue. CRTAC1 promotes cell proliferation, migration and extracellular matrix regeneration and remodeling in primary human fibroblasts (PMID:32084494). CRTAC1 expression is decreased in tissue samples of bladder urothelial carcinoma (PMID:34818994). CRTAC1 overexpression promotes the pyroptosis of human lens epithelial cells by facilitating the reactive oxygen species (ROS) production in the formation of cataract (PMID:32838966). CRTAC1 was the most compelling and robust biomarker for osteoarthritis severity and progression (PMID:35924962).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CRTAC1 antibody CL488-68276Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...