CoraLite® Plus 488-conjugated CRTAC1 Monoclonal antibody

• 

  IF Staining of HeLa using CL488-68276

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 CRTAC1 antibody (CL488-68276, Clone: 2A11E2 ) at dilution of 1:200.

CRTAC1 Monoclonal Antibody for IF/ICC

Cat No. CL488-68276

Clone No.2A11E2

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig, rabbit

Applications

IF/ICC

Synonyms

2A11E2, 68 kDa chondrocyte-expressed protein, ASPIC, ASPIC1, Cartilage acidic protein 1

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68276 targets CRTAC1 in IF/ICC applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32813

  Product name: Recombinant human CRTAC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 99-451 aa of BC034245

  Sequence: VYGNWNGPHRLYLQMSTHGKVRFRDIASPKFSMPSPVRTVITADFDNDQELEIFFNNIAYRSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAPLECGQGFSQQENGHCMDTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKKCSRGYEPNEDGTACVGTLGQSPGPRPTTPTAAAATAAAAAAAGAATAAPVLVDGDLNLGSVVKESCEPSC

• Full Name: cartilage acidic protein 1
• Calculated Molecular Weight: 661 aa, 71 kDa
• Observed Molecular Weight: 71 kDa
• GenBank Accession Number: BC034245
• Gene Symbol: CRTAC1
• Gene ID (NCBI): 55118
• RRID: AB_3672987
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NQ79
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CRTAC1 (cartilage acidic protein 1) is also named as ASPIC1 and CEP68. CRTAC1 is an extracellular matrix protein of human chondrogenic tissue. CRTAC1 promotes cell proliferation, migration and extracellular matrix regeneration and remodeling in primary human fibroblasts (PMID:32084494). CRTAC1 expression is decreased in tissue samples of bladder urothelial carcinoma (PMID:34818994). CRTAC1 overexpression promotes the pyroptosis of human lens epithelial cells by facilitating the reactive oxygen species (ROS) production in the formation of cataract (PMID:32838966). CRTAC1 was the most compelling and robust biomarker for osteoarthritis severity and progression (PMID:35924962).