CSDA Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CSDA Polyclonal antibody, PBS Only (27785-1-PBS)

• 

  WB analysis of KYSE-30 using 27785-1-AP (same clone as 27785-1-PBS)

  WB result of CSDA antibody (27785-1-AP; 1:1000; room temperature for 1.5 hours) with wild-type and CSDA knockout KYSE-30 cells. This data was developed using the same antibody clone with 27785-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27785-1-AP (same clone as 27785-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27785-1-AP (CSDA antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27785-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 27785-1-AP (same clone as 27785-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 27785-1-AP (CSDA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27785-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 27785-1-AP (same clone as 27785-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 27785-1-AP (CSDA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27785-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 27785-1-AP (same clone as 27785-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using CSDA antibody (27785-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 27785-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CSDA Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 27785-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

cold shock domain protein A, Cold shock domain-containing protein A, DBPA, DNA-binding protein A, Single-strand DNA-binding protein NF-GMB

---

Product Information

27785-1-PBS targets CSDA in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26839

  Product name: Recombinant human CSDA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC008801

  Sequence: MSEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLAAAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPR

• Full Name: cold shock domain protein A
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 60-68 kDa
• GenBank Accession Number: BC008801
• Gene Symbol: CSDA
• Gene ID (NCBI): 8531
• RRID: AB_3085996
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P16989
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CSDA (Cold shock domain protein A), also known as DBPA (DNA-binding protein A), YBX3 (Y-box protein 3), is a DNA-binding protein that represses angiogenesis and lymphangiogenesis by directly binding to hypoxia response element (HRE) and serum response element (SRE). CSDA is ubiquitous expressed in human skeletal muscle, heart, and decidual cells, which is thought to a multifunctional epithelial-specific protein involved in gene transcription, DNA repair, and interaction with other proteins (PMID: 33816248). CSDA is a nucleic-acid-binding protein that directly regulates gene expression by using different mechanisms, and acts as a translational repressor (e.g., MYH9 and SPTBN1) and positive regulator of mRNA stability (PMID: 31189097). Western blot analysis detected CDSA at a range of 50~70 kDa due to the anomalous mobility of Y-box proteins (PMID: 38255791).