CSNK2A2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CSNK2A2 Polyclonal antibody, PBS Only (10606-1-PBS)

• 

  WB analysis using 10606-1-AP (same clone as 10606-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10606-1-AP (CSNK2A2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10606-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 10606-1-AP (same clone as 10606-1-PBS)

  IP result of anti-CSNK2A2 (IP:10606-1-AP, 4ug; Detection:10606-1-AP 1:8000) with Jurkat cells lysate 1400 ug. This data was developed using the same antibody clone with 10606-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 10606-1-AP (same clone as 10606-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CSNK2A2 antibody (10606-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 10606-1-PBS in a different storage buffer formulation.

CSNK2A2 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 10606-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

10606-1-PBS targets CSNK2A2 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0877

  Product name: Recombinant human CSNK2A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-350 aa of BC008812

  Sequence: KYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR

• Full Name: casein kinase 2, alpha prime polypeptide
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC008812
• Gene Symbol: CSNK2A2
• Gene ID (NCBI): 1459
• RRID: AB_2292447
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P19784
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CSNK2A2(Casein kinase II subunit alpha') is also named as CK2A3, CK2A2, CSNK2A1, CK2 and belongs to the protein kinase superfamily. It can function as a component of the p53/TP53-dependent spindle assembly checkpoint (SAC) that maintains cyclin-B-CDK1 activity and G2 arrest in response to spindle damage during mitosis. It also can protect against ionizing radiation-induced apoptosis partly by phosphorylating and activating SIRT1. This protein has molecular weights between 35 kDa and 44 kDa(PMID:8622692).