Cystatin SN/CST1 Recombinant monoclonal antibody, PBS Only (Detector)

Cystatin SN/CST1 Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 85403-1-PBS
Clone No.242888B3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Sandwich ELISA, Indirect ELISA, Sample test

CST1, Cystain SA I, Cystain-SA-I, Cystatin 1, cystatin SN

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85403-1-PBS targets Cystatin SN/CST1 as part of a matched antibody pair:

MP01926-3: 85403-4-PBS capture and 85403-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag8862

Product name: Recombinant human CST1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 24-141 aa of BC021225

Sequence: KEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES

Predict reactive species
Full Name cystatin SN
Calculated Molecular Weight 141 aa, 16 kDa
Observed Molecular Weight14-16 kDa
GenBank Accession NumberBC021225
Gene Symbol CST1
Gene ID (NCBI) 1469
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01037
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CST1, or cystatin SN, is a gene in humans that encodes a secreted protein belonging to the type 2 cystatin superfamily, which includes CST1, CST2, CST3, CST4, and CST5. These proteins are cysteine proteinase inhibitors found in various human fluids and secretions, where they appear to provide protective functions . CST1 is specifically found in saliva, tears, urine, and seminal fluid, and it plays a role in inhibiting the activity of cysteine proteases. CST1 has been implicated in various pathological processes, including tumor invasion and metastasis. Overexpression of CST1 has been observed in several types of cancer, such as lung, breast, colorectal, and gastric cancer, suggesting its role in the proliferation, invasion, and metastasis of these tumors.

Loading...
||
New chat

Able

正在加载,请稍候...