CTC1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CTC1 Polyclonal antibody, PBS Only (28268-1-PBS)

• 

  WB analysis using 28268-1-AP (same clone as 28268-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28268-1-AP (C17orf68 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28268-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 28268-1-AP (same clone as 28268-1-PBS)

  WB result of C17orf68 antibody (28268-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-C17orf68 transfected HeLa cells. This data was developed using the same antibody clone with 28268-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 28268-1-AP (same clone as 28268-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using CTC1 antibody (28268-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28268-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CTC1 Polyclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 28268-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF-P, Indirect ELISA

Synonyms

C17orf68, AAF 132, CST complex subunit CTC1, HBV DNAPTP1-transactivated protein B

---

Product Information

28268-1-PBS targets CTC1 in WB, IF-P, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28167

  Product name: Recombinant human C17orf68 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 337-566 aa of BC111783

  Sequence: PSNSEDKKDPESLVRYSRLLSYSGAVTGVLNEPAGLYELDGQLGLCLAYQQFRGLRRVMRPGVCLQLQDVHLLQSVGGGTRRPVLAPCLRGAVLLQSFSRQKPGAHSSRQAYGASLYEQLVWERQLGLPLYLWATKALEELACKLCPHVLRHHQFLQHSSPGSPSLGLQLLAPTLDLLAPPGSPVRNAHNEILEEPHHCPLQKYTRLQTPSSFPTLATLKEEGQRKAWAS

• Full Name: chromosome 17 open reading frame 68
• Calculated Molecular Weight: 1217 aa, 135 kDa
• Observed Molecular Weight: 135-150 kDa
• GenBank Accession Number: BC111783
• Gene Symbol: CTC1
• Gene ID (NCBI): 80169
• RRID: AB_2918152
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q2NKJ3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Conserved telomere maintenance component 1 (CTC1) is a subunit of an alpha accessory factor (AAF) that stimulates the activity of DNA polymerase-alpha-primase, the enzyme that initiates DNA replication (PMID: 19119139). CTC1 also functions in a telomere-associated complex with STN1 and TEN1 (PMID: 19854130).