CTNNBIP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CTNNBIP1 Polyclonal antibody, PBS Only (18347-1-PBS)

• 

  IHC staining of mouse skin using 18347-1-AP (same clone as 18347-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 18347-1-AP (CTNNBIP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18347-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skin using 18347-1-AP (same clone as 18347-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 18347-1-AP (CTNNBIP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18347-1-PBS in a different storage buffer formulation.

CTNNBIP1 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 18347-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

18347-1-PBS targets CTNNBIP1 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13160

  Product name: Recombinant human CTNNBIP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-81 aa of BC014300

  Sequence: MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ

• Full Name: catenin, beta interacting protein 1
• Calculated Molecular Weight: 21 kDa
• GenBank Accession Number: BC014300
• Gene Symbol: CTNNBIP1
• Gene ID (NCBI): 56998
• RRID: AB_3085562
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NSA3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.