CoraLite® Plus 488-conjugated CTPS2 Monoclonal antibody

• 

  IF Staining of human prostate cancer using CL488-67734

  Immunofluorescent analysis of (4% PFA) fixed human prostate cancer tissue using CoraLite® Plus 488 CTPS2 antibody (CL488-67734, Clone: 1A3B8 ) at dilution of 1:200.

CTPS2 Monoclonal Antibody for IF-P

Cat No. CL488-67734

Clone No.1A3B8

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse

Applications

IF-P

Synonyms

CTP synthase 2, CTP synthase II, CTP synthetase 2, CTPS2, DKFZp686C17207, FLJ43358, UTP ammonia ligase 2

---

Tested Applications

• Positive IF-P detected in: human prostate cancer tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67734 targets CTPS2 in IF-P applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30258

  Product name: Recombinant human CTPS2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 30-373 aa of BC034986

  Sequence: CGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDGNKEEPQICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICSIALVGKYTKLRDCYASVFKALEHSALAINHKLNLMYIDSIDLEKITETEDPVKFHEAWQKLCKADGILVPGGF

• Full Name: CTP synthase II
• Calculated Molecular Weight: 586 aa, 66 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC034986
• Gene Symbol: CTPS2
• Gene ID (NCBI): 56474
• RRID: AB_2919531
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NRF8
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CTPS2 (CTP synthase 2) is also named as UTP--ammonia ligase 2 and belongs to the CTP synthase family.It catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as the source of nitrogen and constitutes the rate-limiting enzyme in the synthesis of cytosine nucleotides.