CTRL Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84572-4-RR (same clone as 84572-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84572-4-RR (CTRL antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84572-4-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse pancreas using 84572-4-RR (same clone as 84572-4-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 84572-4-RR (CTRL antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84572-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 84572-4-RR (same clone as 84572-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 84572-4-RR (CTRL antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84572-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 84572-4-RR (same clone as 84572-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 84572-4-RR (CTRL antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84572-4-PBS in a different storage buffer formulation.

CTRL Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84572-4-PBS

Clone No.241858D7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

241858D7, chymotrypsin like, Chymotrypsin-like protease CTRL-1, CTRL1, EC:3.4.21.-

---

Product Information

84572-4-PBS targets CTRL in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2214

  Product name: Recombinant Human CTRL protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 19-264 aa of BC063475

  Sequence: CGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN

• Full Name: chymotrypsin-like
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 25-28 kDa
• GenBank Accession Number: BC063475
• Gene Symbol: CTRL
• Gene ID (NCBI): 1506
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P40313
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CTRL(Chymotrypsin-like protease) is also named as CTRL1 and belongs to the peptidase S1 family. The CTRL1 enzyme is active over a broad pH range. It expresses in pancreas and presence in intestinal fluid after stimulation of pancreatic secretion as a digestive enzyme(PMID:9065485). This gene encode a protein of 264 amino acid and the protein has a signal peptide of 18 amino acid and a propeptide of 15 amino acid.