Anti-Human CXCL10/IP-10 Rabbit Recombinant Antibody

• 

  FC experiment of human PBMCs using 98265-1-RR

  1x10^6 untreated or IFN gamma and brefeldin A treated human PBMCs were intracellularly stained with 0.25 ug Anti-Human CXCL10/IP-10 Rabbit Recombinant Antibody (98265-1-RR, Clone: 242013E12) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

CXCL10/IP-10 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98265-1-RR

Clone No.242013E12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

CXCL10, CXCL10/IP10, IP10, 10 kDa interferon gamma-induced protein, 242013E12

---

Tested Applications

• Positive FC (Intra) detected in: IFN gamma and brefeldin A treated human PBMCs

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98265-1-RR targets CXCL10/IP-10 in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2489

  Product name: Recombinant Human CXCL10/IP-10 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-98 aa of BC010954

  Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

• Full Name: chemokine (C-X-C motif) ligand 10
• Calculated Molecular Weight: 11 kDa
• GenBank Accession Number: BC010954
• Gene Symbol: CXCL10
• Gene ID (NCBI): 3627
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P02778
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

CXCL10 (also known as IP-10) is a member of the CXC chemokine family which binds to the CXCR3 receptor to exert its biological effects. CXCL10 is a 12-kDa protein and constitutes two internal disulfide cross bridges. The predicted signal peptidase cleavage generates a 10-kDa secreted polypeptide with four conserved cysteine residues in the N-terminal. The CXCL10 gene localizes on chromosome 4 at band q21, a locus associated with an acute monocytic/B-lymphocyte lineage leukemia exhibiting translocation of t (4; 11) (q21; q23). CXCL10 mediates leukocyte trafficking, adaptive immunity, inflammation, haematopoiesis and angiogenesis. Under proinflammatory conditions CXCL10 is secreted from a variety of cells, such as leukocytes, activated neutrophils, eosinophils, monocytes, epithelial cells, endothelial cells, stromal cells (fibroblasts) and keratinocytes in response to IFN-γ.