Anti-Human CXCL10/IP-10 Rabbit Recombinant Antibody

• 

  FC experiment of human PBMCs using 98265-4-RR

  1x10^6 untreated or IFN gamma and brefeldin A treated human PBMCs were intracellularly stained with 0.25 ug Anti-Human CXCL10/IP-10 Rabbit RecAb (98265-4-RR, Clone:250120D9) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 647 Anti-Human CD14. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  FC experiment of human PBMCs using 98265-4-RR

  1x10^6 IFN gamma and Brefeldin A treated human PBMCs were intracellularly stained with 0.25 ug Anti-Human CXCL10/IP-10 Rabbit RecAb (98265-4-RR, Clone:250120D9) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). 1x10^6 untreated PBMCs were intracellularly stained with 0.25 ug Anti-Human CXCL10/IP-10 Rabbit RecAb (98265-4-RR, Clone: 250120D9) (black, dashed) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

CXCL10/IP-10 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98265-4-RR

Clone No.250120D9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

CXCL10, CXCL10/IP10, IP10, 10 kDa interferon gamma-induced protein, C X C motif chemokine 10

---

Tested Applications

• Positive FC (Intra) detected in: IFN gamma and Brefeldin A treated human PBMCs

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98265-4-RR targets CXCL10/IP-10 in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2489

  Product name: Recombinant Human CXCL10/IP-10 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-98 aa of BC010954

  Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

• Full Name: chemokine (C-X-C motif) ligand 10
• Calculated Molecular Weight: 11 kDa
• GenBank Accession Number: BC010954
• Gene Symbol: CXCL10
• Gene ID (NCBI): 3627
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02778
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

CXCL10 (also known as IP-10) is a member of the CXC chemokine family which binds to the CXCR3 receptor to exert its biological effects. CXCL10 is a 12-kDa protein and constitutes two internal disulfide cross bridges. The predicted signal peptidase cleavage generates a 10-kDa secreted polypeptide with four conserved cysteine residues in the N-terminal. The CXCL10 gene localizes on chromosome 4 at band q21, a locus associated with an acute monocytic/B-lymphocyte lineage leukemia exhibiting translocation of t (4; 11) (q21; q23). CXCL10 mediates leukocyte trafficking, adaptive immunity, inflammation, haematopoiesis and angiogenesis. Under proinflammatory conditions CXCL10 is secreted from a variety of cells, such as leukocytes, activated neutrophils, eosinophils, monocytes, epithelial cells, endothelial cells, stromal cells (fibroblasts) and keratinocytes in response to IFN-γ.