FcZero-rAb® APC Anti-Human CXCL9/MIG Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® APC Anti-Human CXCL9/MIG Rabbit Recombinant Antibody (APC-FcA98211)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CXCL9/MIG FcZero-rAb^® Recombinant Antibody for FC (Intra)

Cat No. APC-FcA98211 Copied!

Clone No. 241437F5

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

CXCL9, MIG, MIG; CXCL9, CMK, C-X-C motif chemokine 9

• 

  FC experiment of human PBMCs using APC-FcA98211

  1x10^6 untreated or IFN gamma, TNF alpha and Brefeldin A-treated human PBMCs were intracellularly stained with PE Anti-Human CD14 and 5 ul APC Anti-Human CXCL9/MIG Rabbit RecAb (APC-FcA98211, Clone: 241437F5). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CXCL9/MIG in ?

Chat with Able

---

Tested Applications

• Positive FC (Intra) detected in: IFN gamma, TNF alpha and Brefeldin A treated human PBMCs

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

APC-FcA98211 targets CXCL9/MIG in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17932

  Product name: Recombinant human CXCL9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-125 aa of BC095396

  Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

• Full Name: chemokine (C-X-C motif) ligand 9
• Calculated Molecular Weight: 14 kDa
• GenBank Accession Number: BC095396
• Gene Symbol: CXCL9
• Gene ID (NCBI): 4283
• RRID: AB_3746590
• Conjugate: APC Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q07325
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CXCL9 is a small cytokine known as MIG. CXCL9 is a T-cell chemoattractant, which is induced by IFN-γ. It is closely related to two other CXC chemokines called CXCL10 and CXCL11, whose genes are located near the gene for CXCL9 on human chromosome 4. A high level of CXCL9 revealed in peripheral liquids, can be considered as a marker of host immune response, especially of that involving Th1 cells.