• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated CXCR2 Polyclonal antibody

CXCR2 Polyclonal Antibody for IF/ICC
Cat No. CL488-20634

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

CD182, CDw128b, CMKAR2, CXC R2, CXCR 2, CXCR2, GRO/MGSA receptor, IL 8 receptor type 2, IL 8R B, IL8R2, IL8RA, IL8RB, interleukin 8 receptor, beta

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-20634 targets CXCR2 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14670

Product name: Recombinant human IL-8RB/CXCR2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-57 aa of BC037961

Sequence: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYAL

Predict reactive species
Full Name interleukin 8 receptor, beta
Calculated Molecular Weight 360 aa, 41 kDa
Observed Molecular Weight 45-50 kDa
GenBank Accession NumberBC037961
Gene Symbol IL8RB
Gene ID (NCBI) 3579
RRIDAB_3084037
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP25025
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

IL8RB, also named as CXCR2, GRO/MGSA receptor, IL-8 receptor type 2, CDw128b and CD182, belongs to the G-protein coupled receptor 1 family. It is a receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. It binds to IL-8 with high affinity. IL8RB also binds with high affinity to CXCL3, GRO/MGSA and NAP-2. This antibody is specific to human IL8RB.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CXCR2 antibody CL488-20634Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...