CYP27A1 Monoclonal antibody, PBS Only

• 

  WB analysis of Caco-2 using 67045-1-Ig (same clone as 67045-1-PBS)

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 67045-1-Ig (CYP27A1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67045-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67045-1-Ig (same clone as 67045-1-PBS)

  WB result of CYP27A1 antibody (67045-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CYP27A1 transfected HepG2 cells. This data was developed using the same antibody clone with 67045-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67045-1-Ig (same clone as 67045-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67045-1-Ig (CYP27A1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67045-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HT-29 using 67045-1-Ig (same clone as 67045-1-PBS)

  HT-29 cells were subjected to SDS PAGE followed by western blot with 67045-1-Ig (CYP27A1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67045-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67045-1-Ig (same clone as 67045-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67045-1-Ig (CYP27A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67045-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HT-29 using 67045-1-Ig (same clone as 67045-1-PBS)

  HT-29 cells were subjected to SDS PAGE followed by western blot with 67045-1-Ig (CYP27A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67045-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat liver using 67045-1-Ig (same clone as 67045-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 67045-1-Ig (CYP27A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67045-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67045-1-Ig (same clone as 67045-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67045-1-Ig (CYP27A1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67045-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67045-1-Ig (same clone as 67045-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67045-1-Ig (CYP27A1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67045-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver cancer using 67045-1-Ig (same clone as 67045-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using CYP27A1 antibody (67045-1-Ig, Clone: 3G3F7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67045-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver cancer using 67045-1-Ig (same clone as 67045-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using CYP27A1 antibody (67045-1-Ig, Clone: 3G3F7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67045-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CYP27A1 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 67045-1-PBS

Clone No.3G3F7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

3G3F7, 5-beta-cholestane-3-alpha,7-alpha,12-alpha-triol 26-hydroxylase, CP27, CTX, CYP27

---

Product Information

67045-1-PBS targets CYP27A1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7746

  Product name: Recombinant human CYP27A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 183-531 aa of BC051851

  Sequence: DDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC

• Full Name: cytochrome P450, family 27, subfamily A, polypeptide 1
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 54-60 kDa
• GenBank Accession Number: BC051851
• Gene Symbol: CYP27A1
• Gene ID (NCBI): 1593
• RRID: AB_2882359
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q02318
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.