CYP27A1 Monoclonal antibody

• 

  WB analysis of HepG2 using 67045-1-Ig

  WB result of CYP27A1 antibody (67045-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CYP27A1 transfected HepG2 cells.

• 

  WB analysis of Caco-2 using 67045-1-Ig

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 67045-1-Ig (CYP27A1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat liver using 67045-1-Ig

  rat liver tissue were subjected to SDS PAGE followed by western blot with 67045-1-Ig (CYP27A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 67045-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67045-1-Ig (CYP27A1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HT-29 using 67045-1-Ig

  HT-29 cells were subjected to SDS PAGE followed by western blot with 67045-1-Ig (CYP27A1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 67045-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67045-1-Ig (CYP27A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HT-29 using 67045-1-Ig

  HT-29 cells were subjected to SDS PAGE followed by western blot with 67045-1-Ig (CYP27A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 67045-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67045-1-Ig (CYP27A1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 67045-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67045-1-Ig (CYP27A1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human liver cancer using 67045-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using CYP27A1 antibody (67045-1-Ig, Clone: 3G3F7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of human liver cancer using 67045-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using CYP27A1 antibody (67045-1-Ig, Clone: 3G3F7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• Featured Product
• KD/KO Validated

CYP27A1 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 67045-1-Ig

Clone No.3G3F7

Publications(7)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

3G3F7, 5-beta-cholestane-3-alpha,7-alpha,12-alpha-triol 26-hydroxylase, CP27, CTX, CYP27

---

Tested Applications

• Positive WB detected in: Caco-2 cells, HepG2 cells, HT-29 cells, rat liver tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human liver cancer tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

67045-1-Ig targets CYP27A1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7746

  Product name: Recombinant human CYP27A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 183-531 aa of BC051851

  Sequence: DDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC

• Full Name: cytochrome P450, family 27, subfamily A, polypeptide 1
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 54-60 kDa
• GenBank Accession Number: BC051851
• Gene Symbol: CYP27A1
• Gene ID (NCBI): 1593
• RRID: AB_2882359
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q02318
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Bone Miner Res; CYP4A22 Loss-of-Function Causes A New Type of Vitamin D-dependent Rickets (VDDR1C); Authors - Xiaohong Duan
mouse	WB	J Ethnopharmacol; Penthorum chinense Pursh. extract attenuates non-alcholic fatty liver disease by regulating gut microbiota and bile acid metabolism in mice.; Authors - Xiaoxi Li
mouse	WB	Nat Microbiol; Akkermansia muciniphila protects mice against an emerging tick-borne viral pathogen; Authors - Jinyan Xie
human	WB	Front Immunol; Construction of a lipid metabolism-related risk model for hepatocellular carcinoma by single cell and machine learning analysis; Authors - Lisha Mou
mouse	WB	Adv Sci (Weinh); Geniposidic Acid Targeting FXR "S332 and H447" Mediated Conformational Change to Upregulate CYPs and miR-19a-3p to Ameliorate Drug-Induced Liver Injury; Authors - Minqi Fan
rat	WB,IF	J Ethnopharmacol; Integration of network pharmacology, UHPLC-Q exactive orbitrap HRMS technique and metabolomics to elucidate the active ingredients and mechanisms of compound danshen pills in treating hypercholesterolemic rats; Authors - Shanlan Li