CYP4F12 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CYP4F12 Polyclonal antibody, PBS Only (13243-1-PBS)

• 

  WB analysis of human placenta using 13243-1-AP (same clone as 13243-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 13243-1-AP (CYP4F12 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13243-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 13243-1-AP (same clone as 13243-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13243-1-AP (CYP4F12 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13243-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 13243-1-AP (same clone as 13243-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13243-1-AP (CYP4F12 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13243-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 13243-1-AP (same clone as 13243-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13243-1-AP (CYP4F12 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13243-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 13243-1-AP (same clone as 13243-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 13243-1-AP (CYP4F12 antibody) at dilution of 1:500 (under 40x lens). This data was developed using the same antibody clone with 13243-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 13243-1-AP (same clone as 13243-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CYP4F12 antibody (13243-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 13243-1-PBS in a different storage buffer formulation.

CYP4F12 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 13243-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CYPIVF12, Cytochrome P450 4F12, EC:1.14.14.1, UNQ568/PRO1129

---

Product Information

13243-1-PBS targets CYP4F12 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3957

  Product name: Recombinant human CYP4F12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 225-524 aa of BC035350

  Sequence: ILELSALVEKRSQHILQHMDFLYYLSHDGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDVLLLSKDEDGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDRDPKEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGRVIPKGITCLIDIIGVHHNPTVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHFRFLPDHTEPRRKLELIMRAEGGLWLRVEPLNVSLQ

• Full Name: cytochrome P450, family 4, subfamily F, polypeptide 12
• Calculated Molecular Weight: 524 aa, 60 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC035350
• Gene Symbol: CYP4F12
• Gene ID (NCBI): 66002
• RRID: AB_2088412
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HCS2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CYP4F12(Cytochrome P450 4F12) Catalyzes leukotriene B4 omega-hydroxylation and arachidonic acid omega-hydroxylation but with an activity much lower than that of CYP4F2. It expresses a band of 60KDa in adult and fetal liver, kidney, placenta at term, seminal vesicles, and the prostate gland(PMID:15078342). And it can be phosphorylated in vivo(PMID:18828626).