Home
Products
Primary Antibodies
Calmodulin 1/2/3 Polyclonal antibody, PBS Only (28270-1-PBS)

Filter: AllWBIHCIF/ICC

WB analysis using 28270-1-AP (same clone as 28270-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 28270-1-AP (Calmodulin 1/2/3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28270-1-PBS in a different storage buffer formulation.
IHC staining of rat brain using 28270-1-AP (same clone as 28270-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 28270-1-AP (Calmodulin 1/2/3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28270-1-PBS in a different storage buffer formulation.
IHC staining of rat brain using 28270-1-AP (same clone as 28270-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 28270-1-AP (Calmodulin 1/2/3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28270-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 28270-1-AP (same clone as 28270-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28270-1-AP (Calmodulin 1/2/3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28270-1-PBS in a different storage buffer formulation.
IHC staining of mouse skeletal muscle using 28270-1-AP (same clone as 28270-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 28270-1-AP (Calmodulin 1/2/3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28270-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 28270-1-AP (same clone as 28270-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Calmodulin 1/2/3 antibody (28270-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 28270-1-PBS in a different storage buffer formulation.

Calmodulin 1/2/3 Polyclonal antibody, PBS Only

Name: Calmodulin 1/2/3 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 28270-1-PBS

Calmodulin 1/2/3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 28270-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CALM2, CALM, CALM1, CALM3, CALML2

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

28270-1-PBS targets Calmodulin 1/2/3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag28000 Product name: Recombinant human CALM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 72-149 aa of BC006464 Sequence: MMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK Predict reactive species
Full Name	calmodulin 2 (phosphorylase kinase, delta)
Calculated Molecular Weight	17 kDa
Observed Molecular Weight	17-22 kDa
GenBank Accession Number	BC006464
Gene Symbol	Calmodulin 1
Gene ID (NCBI)	805
RRID	AB_3669650
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P62158
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Calmodulin is the most widely distributed and most versatile member of a family of calcium-binding proteins which probably serve as receptors for the Ca2+ signal. Through the regulation of a wide variety of intracellular enzymes, calmodulin plays a key role in many physiological processes (PMID: 6313166).