CoraLite® Plus 750-conjugated Caspase 1 Recombinant monoclonal antibody

Caspase 1 Uni-rAb® Recombinant Antibody for WB
Cat No. CL750-81482
Clone No.1O18

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB

CASP1, Caspase1, Caspase-1, CASP-1, CASP 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inTHP-1 cells, U-937 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-81482 targets Caspase 1 in WB applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag11143

Product name: Recombinant human Caspase 1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-311 aa of BC062327

Sequence: MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH

Predict reactive species
Full Name caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase)
Calculated Molecular Weight 404 aa, 45 kDa
Observed Molecular Weight30 kDa, 35 kDa, 43-45 kDa
GenBank Accession NumberBC062327
Gene Symbol Caspase 1
Gene ID (NCBI) 834
RRIDAB_3673728
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP29466
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CASP1(caspase-1) is also named as IL1BC, IL1BCE and belongs to the peptidase C14A family. It is a cysteine protease that regulates inflammatory processes through its capacity to process and activate the interleukin-1-beta (IL1B), IL18, and IL33 precursor proteins. The active caspase-1 can increase cellular membrane permeability and intracellular calcium levels, which facilitates lysosome exocytosis and release of host antimicrobial factors and microbial products (PMID:21804020). It has 5 isoforms produced by alternative splicing. 81482-1-RR can recognize the splicing isoforms of caspase 1.

Protocols

Product Specific Protocols
WB protocol for CL Plus 750 Caspase 1 antibody CL750-81482Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...