Home
Products
Primary Antibodies
Cathepsin A Polyclonal antibody, PBS Only (15020-1-PBS)

Filter: AllWBIHC

WB analysis using 15020-1-AP (same clone as 15020-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 15020-1-AP (Cathepsin A antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15020-1-PBS in a different storage buffer formulation.
WB analysis using 15020-1-AP (same clone as 15020-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 15020-1-AP (Cathepsin A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15020-1-PBS in a different storage buffer formulation.
WB analysis of Sp2/0 using 15020-1-AP (same clone as 15020-1-PBS)
Sp2/0 cells were subjected to SDS PAGE followed by western blot with 15020-1-AP (Cathepsin A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15020-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 15020-1-AP (same clone as 15020-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15020-1-AP (Cathepsin A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15020-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 15020-1-AP (same clone as 15020-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15020-1-AP (Cathepsin A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15020-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 15020-1-AP (same clone as 15020-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15020-1-AP (Cathepsin A antibody) at dilution of 1:1500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15020-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 15020-1-AP (same clone as 15020-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15020-1-AP (Cathepsin A antibody) at dilution of 1:1500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15020-1-PBS in a different storage buffer formulation.
IHC staining of rat kidney using 15020-1-AP (same clone as 15020-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 15020-1-AP (Cathepsin A antibody) at dilution of 1:1500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15020-1-PBS in a different storage buffer formulation.
IHC staining of rat kidney using 15020-1-AP (same clone as 15020-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 15020-1-AP (Cathepsin A antibody) at dilution of 1:1500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15020-1-PBS in a different storage buffer formulation.

Cathepsin A Polyclonal antibody, PBS Only

Name: Cathepsin A Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 15020-1-PBS

Cathepsin A Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15020-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

15020-1-PBS targets Cathepsin A in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag7073 Product name: Recombinant human CTSA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 133-479 aa of BC000597 Sequence: FSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY Predict reactive species
Full Name	cathepsin A
Calculated Molecular Weight	54 kDa
Observed Molecular Weight	54-60, 32, 20 kDa
GenBank Accession Number	BC000597
Gene Symbol	Cathepsin A
Gene ID (NCBI)	5476
RRID	AB_10696309
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P10619
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

CTSA is also named as PPGB(protective protein for beta-galactosidase), PPCA(protective protein cathepsin A), cathepsin A, carboxypeptidase C, carboxypeptidase L and belongs to the peptidase S10 family. It is a ubiquitously expressed multifunctional enzyme, with deamidase, esterase, and carboxypeptidase activities and a preference for substrates with hydrophobic amino acid residues at the P1-prime position. It can be cleaved into the following 2 chains and defects in CTSA are the cause of galactosialidosis (GSL). This protein has 2 glycosylation sites. CTSA is synthesized as a 54-kDa precursor protein and composed of 32- and 20-kDa subunits linked together by disulfide bonds(PMID: 16461364,19574551).