Cathepsin D Recombinant monoclonal antibody, PBS Only (Detector)

Cathepsin D Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), Sandwich ELISA, Indirect ELISA
Cat No. 83743-2-PBS
Clone No.240775E7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), Sandwich ELISA, Indirect ELISA

CTSD, 240775E7, Cathepsin D heavy chain, Cathepsin D light chain, CLN10

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83743-2-PBS targets Cathepsin D as part of a matched antibody pair:

MP00695-4: 83743-6-PBS capture and 83743-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1053

Product name: Recombinant Human Cathepsin D protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 21-412 aa of NM_001909.5

Sequence: LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL

Predict reactive species
Full Name cathepsin D
Calculated Molecular Weight45kDa
Observed Molecular Weight 32 kDa, 48 kDa, 52 kDa
GenBank Accession NumberNM_001909.5
Gene Symbol Cathepsin D
Gene ID (NCBI) 1509
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP07339
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CTSD (Cathepsin D) also named CPSD, belongs to the peptidase A1 family. It is ubiquitously expressed and is involved in proteolytic degradation, cell invasion, and apoptosis. Human CTSD is synthesized as a 52-kDa precursor that is converted into an active 48-kDa single-chain intermediate in the endosomes, and then into a fully active mature form, composed of a 34-kDa heavy chain and a 14-kDa light chain, in the lysosomes. It is a lysosomal acid protease found in neutrophils and monocytes and involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease (PMID: 27114232, PMID: 30717773, PMID: 30051532).

Loading...
||
New chat

Able

正在加载,请稍候...