Cathepsin D Recombinant monoclonal antibody

Cathepsin D Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA
Cat No. 83743-2-RR
Clone No.240775E7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), ELISA

CTSD, 240775E7, Cathepsin D heavy chain, Cathepsin D light chain, CLN10

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, MCF-7 cells, SH-SY5Y cells
Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83743-2-RR targets Cathepsin D in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1053

Product name: Recombinant Human Cathepsin D protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 21-412 aa of NM_001909.5

Sequence: LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL

Predict reactive species
Full Name cathepsin D
Calculated Molecular Weight45kDa
Observed Molecular Weight 32 kDa, 48 kDa, 52 kDa
GenBank Accession NumberNM_001909.5
Gene Symbol Cathepsin D
Gene ID (NCBI) 1509
RRIDAB_3671341
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP07339
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CTSD (Cathepsin D) also named CPSD, belongs to the peptidase A1 family. It is ubiquitously expressed and is involved in proteolytic degradation, cell invasion, and apoptosis. Human CTSD is synthesized as a 52-kDa precursor that is converted into an active 48-kDa single-chain intermediate in the endosomes, and then into a fully active mature form, composed of a 34-kDa heavy chain and a 14-kDa light chain, in the lysosomes. It is a lysosomal acid protease found in neutrophils and monocytes and involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease (PMID: 27114232, PMID: 30717773, PMID: 30051532).

Protocols

Product Specific Protocols
FC protocol for Cathepsin D antibody 83743-2-RRDownload protocol
IF protocol for Cathepsin D antibody 83743-2-RRDownload protocol
WB protocol for Cathepsin D antibody 83743-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Isaure (Verified Customer) (05-26-2025)

Sat 5% milk Incubation Primary Ab ON at 4°C (2 exposure times in the uploaded image)

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/10000
  • Cell Tissue Type: 48h conditoned media of TNBC cell lines
Cathepsin D Antibody Western Blot validation (1/10000 dilution) in 48h conditoned media of TNBC cell lines (Cat no:83743-2-RR)
Loading...
||
New chat Able
正在加载,请稍候...