Cathepsin K Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Cathepsin K Polyclonal antibody, PBS Only (11239-1-PBS)

• 

  WB analysis using 11239-1-AP (same clone as 11239-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 11239-1-AP (Cathepsin K antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11239-1-PBS in a different storage buffer formulation.

• 

  IP experiment of ROS1728 using 11239-1-AP (same clone as 11239-1-PBS)

  IP result of anti-Cathepsin K (IP:11239-1-AP, 3ug; Detection:11239-1-AP 1:500) with ROS1728 cells lysate 3200ug. This data was developed using the same antibody clone with 11239-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 11239-1-AP (same clone as 11239-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11239-1-AP (Cathepsin K antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11239-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 11239-1-AP (same clone as 11239-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11239-1-AP (Cathepsin K antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11239-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 11239-1-AP (same clone as 11239-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11239-1-AP (Cathepsin K antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11239-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 11239-1-AP (same clone as 11239-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11239-1-AP (Cathepsin K antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11239-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 11239-1-AP (same clone as 11239-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 11239-1-AP (Cathepsin K antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 11239-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human osteosarcoma using 11239-1-AP (same clone as 11239-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human osteosarcoma slide using 11239-1-AP (Cathepsin K antibody at dilution of 1:100. This data was developed using the same antibody clone with 11239-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human osteosarcoma using 11239-1-AP (same clone as 11239-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human osteosarcoma slide using 11239-1-AP (Cathepsin K antibody at dilution of 1:100. This data was developed using the same antibody clone with 11239-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 11239-1-AP (same clone as 11239-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using Cathepsin K antibody (11239-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11239-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 11239-1-AP (same clone as 11239-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using Cathepsin K antibody (11239-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11239-1-PBS in a different storage buffer formulation.

• 

  IF Staining of ROS1728 using 11239-1-AP (same clone as 11239-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed ROS1728 cells using Cathepsin K antibody (11239-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 11239-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Cathepsin K Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA

Cat No. 11239-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA

Synonyms

CTSK, Cathepsin X, catK, CTSO, CTSO2

---

Product Information

11239-1-PBS targets Cathepsin K in WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1761

  Product name: Recombinant human CTSK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-329 aa of BC016058

  Sequence: MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM

• Full Name: cathepsin K
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 27 kDa, 38~46 kDa
• GenBank Accession Number: BC016058
• Gene Symbol: Cathepsin K
• Gene ID (NCBI): 1513
• RRID: AB_2245581
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P43235
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CTSK(cathepsin K), also named CTSO, CTSO2, is a recently identified lysosomal cysteine proteinase. CTSK is synthesized as a proenzyme of 38 kDa and subsequently enters acidic lysosomal compartments, in which the propeptide is cleaved and transformed into an active enzyme and it may influence adipocyte differentiation through modifying extracellular matrix components(PMID:16912123). It is revealed both the 46-kDa cathepsin-K precursor and the 30-kDa mature form in mouse bone extracts (PMID:9811821). The high CTSK protein levels are only detected in primary cultured fibroblasts derived from normal and neoplastic breast tissue, where the 37- and 25-kDa bands to be detected correspond to pro- and mature proteins through western blot (PMID:18765527). The full length protein has a signal peptides with 15 amino acids and a propeptide with 99 amino acids. CTSK may have cross reaction with the other members of cathepsin family and form a complex of 70 kDa with an unidentified subunit(PMID:1930136).