Filter: AllWBIHCIF

WB analysis of rat liver using 66156-1-Ig (same clone as 66156-1-PBS)
rat liver tissue were subjected to SDS PAGE followed by western blot with 66156-1-Ig (Ceruloplasmin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66156-1-PBS in a different storage buffer formulation.
WB analysis of human placenta using 66156-1-Ig (same clone as 66156-1-PBS)
human placenta tissue were subjected to SDS PAGE followed by western blot with 66156-1-Ig (Ceruloplasmin antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66156-1-PBS in a different storage buffer formulation.
WB analysis of HSC-T6 using 66156-1-Ig (same clone as 66156-1-PBS)
HSC-T6 cells were subjected to SDS PAGE followed by western blot with 66156-1-Ig (Ceruloplasmin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66156-1-PBS in a different storage buffer formulation.
WB analysis of human kidney using 66156-1-Ig (same clone as 66156-1-PBS)
human kidney tissue were subjected to SDS PAGE followed by western blot with 66156-1-Ig (Ceruloplasmin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66156-1-PBS in a different storage buffer formulation.
WB analysis of human blood using 66156-1-Ig (same clone as 66156-1-PBS)
human blood was subjected to SDS PAGE followed by western blot with 66156-1-Ig (Ceruloplasmin antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66156-1-PBS in a different storage buffer formulation.
IHC staining of human ovary tumor using 66156-1-Ig (same clone as 66156-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66156-1-Ig (Ceruloplasmin antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66156-1-PBS in a different storage buffer formulation.
IHC staining of human ovary tumor using 66156-1-Ig (same clone as 66156-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66156-1-Ig (Ceruloplasmin antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66156-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 66156-1-Ig (same clone as 66156-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66156-1-Ig (Ceruloplasmin antibody at dilution of 1:50. This data was developed using the same antibody clone with 66156-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 66156-1-Ig (same clone as 66156-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66156-1-Ig (Ceruloplasmin antibody at dilution of 1:50. This data was developed using the same antibody clone with 66156-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 66156-1-Ig (same clone as 66156-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 66156-1-Ig (Ceruloplasmin antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66156-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 66156-1-Ig (same clone as 66156-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 66156-1-Ig (Ceruloplasmin antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66156-1-PBS in a different storage buffer formulation.
IHC staining of human ovary tumor using 66156-1-Ig (same clone as 66156-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66156-1-Ig (Ceruloplasmin antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66156-1-PBS in a different storage buffer formulation.
IHC staining of human ovary tumor using 66156-1-Ig (same clone as 66156-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66156-1-Ig (Ceruloplasmin antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66156-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 66156-1-Ig (same clone as 66156-1-PBS)
Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Ceruloplasmin antibody (66156-1-Ig, Clone: 3C8A5 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66156-1-PBS in a different storage buffer formulation.

Ceruloplasmin Monoclonal antibody, PBS Only

Ceruloplasmin Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66156-1-PBS

Clone No.3C8A5

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Ceruloplasmin, ceruloplasmin (ferroxidase), CP, CP 2, Ferroxidase

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

66156-1-PBS targets Ceruloplasmin in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity	human, rat
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag15535 Product name: Recombinant human CP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 194-446 aa of BC146663 Sequence: IGPLIICKKDSLDKEKEKHIDREFVVMFSVVDENFSWYLEDNIKTYCSEPEKVDKDNEDFQESNRMYSVNGYTFGSLPGLSMCAEDRVKWYLFGMGNEVDVHAAFFHGQALTNKNYRIDTINLFPATLFDAYMVAQNPGEWMLSCQNLNHLKAGLQAFFQVQECNKSSSKDNIRGKHVRHYYIAAEEIIWNYAPSGIDIFTKENLTAPGSDSAVFFEQGTTRIGGSYKKLVYREYTDASFTNRKERGPEEEHL Predict reactive species
Full Name	ceruloplasmin (ferroxidase)
Calculated Molecular Weight	1065 aa, 122 kDa
Observed Molecular Weight	140 kDa
GenBank Accession Number	BC146663
Gene Symbol	Ceruloplasmin
Gene ID (NCBI)	1356
RRID	AB_2881552
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	P00450
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Ceruloplasmin (CP) is a serum glycoprotein synthesized by hepatocytes and functions as the major transport protein of copper in blood where it acts as ferrodoxidase and is required for iron transport of transferrin. The intact ceruloplasmin migrated around 130-140 kDa and some proteolytic cleaved fragments could also be observed.