Claudin 2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Claudin 2 Polyclonal antibody, PBS Only (26912-1-PBS)

• 

  WB analysis using 26912-1-AP (same clone as 26912-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26912-1-AP (Claudin 2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26912-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 26912-1-AP (same clone as 26912-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26912-1-AP (Claudin 2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26912-1-PBS in a different storage buffer formulation.

Claudin 2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 26912-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CLDN2, SP82, PSEC0059

---

Product Information

26912-1-PBS targets Claudin 2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25527

  Product name: Recombinant human CLDN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 184-230 aa of BC014424

  Sequence: SCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV

• Full Name: claudin 2
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC014424
• Gene Symbol: Claudin 2
• Gene ID (NCBI): 9075
• RRID: AB_2918115
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P57739
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Claudin 2, also named as SP82, belongs to the claudin family. Claudin 2 is a tetraspan membrane protein consisting of two extracellular domains (ECL1 and ECL2), a small intracellular loop connecting the second and third transmembrane sections and short intracellular N and C terminal portions. Claudin 2 is a cation-selective channel forming TJ protein expressed in leaky epithelia. Claudin 2 is a 230 amino acid transmembrane protein, with a calculated molecular mass of 25 kDa (PMID: 31726679)