Product Information
26912-1-PBS targets Claudin 2 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25527 Product name: Recombinant human CLDN2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 184-230 aa of BC014424 Sequence: SCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV Predict reactive species |
| Full Name | claudin 2 |
| Calculated Molecular Weight | 25 kDa |
| Observed Molecular Weight | 25 kDa |
| GenBank Accession Number | BC014424 |
| Gene Symbol | Claudin 2 |
| Gene ID (NCBI) | 9075 |
| RRID | AB_2918115 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P57739 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Claudin 2, also named as SP82, belongs to the claudin family. Claudin 2 is a tetraspan membrane protein consisting of two extracellular domains (ECL1 and ECL2), a small intracellular loop connecting the second and third transmembrane sections and short intracellular N and C terminal portions. Claudin 2 is a cation-selective channel forming TJ protein expressed in leaky epithelia. Claudin 2 is a 230 amino acid transmembrane protein, with a calculated molecular mass of 25 kDa (PMID: 31726679)



