Mouse Tissue Factor/CD142 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP00859-1

  Sandwich ELISA standard curve of MP00859-1, Mouse Tissue Factor Recombinant Matched Antibody Pair - PBS only. 83887-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg1102. 83887-4-PBS was HRP conjugated as the detection antibody. Range: 7.8-500 pg/mL.

• 

  Sample test of MP00859-1

  Urine of mice was measured. The Tissue Factor concentration of detected samples was determined to be 244.1 pg/mL.

• 

  Sample test of MP00859-1

  The mean Tissue Factor concentration was determined to be 18.4 ng/mL in mouse brain tissue extract based on a 6.0 mg/mL extract load, 13.1 ng/mL in C2C12 cell extract based on a 3.6 mg/mL extract load and 2.7 ng/mL in NIH/3T3 cell extract based on a 10.6 mg/mL extract load.

• 

  Sample test of MP00859-1

  Serum of sixteen mice was measured. The Tissue Factor concentration of detected samples was determined to be 86.6 pg/mL with a range of 63.0-105.0 pg/mL.

• 

  Cytometric bead array standard curve of MP00859-1

  Cytometric bead array standard curve of MP00859-1, MOUSE Tissue Factor Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83887-1-PBS. Detection antibody: 83887-4-PBS. Standard: Eg1102. Range: 0.313-40 ng/mL.

• 

  Affinity and Kinetic Characterization of 83887-1-PBS

  Biolayer interferometry (BLl) kinetic assay of 83887-1-PBS against Mouse Tissue Factor/CD142 was performed. The affinity constant is 0.778 nM.

Tissue Factor/CD142 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83887-1-PBS

Clone No.240875A2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

CD142, Coagulation factor III, F3, Tissue factor, TF

---

Product Information

83887-1-PBS targets Tissue Factor/CD142 as part of a matched antibody pair:

MP00859-1: 83887-1-PBS capture and 83887-4-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1102

  Product name: Recombinant Mouse Tissue Factor protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 29-251 aa of

  Sequence: AGIPEKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKNKCFSTTDTECDLTDEIVKDVTWAYEAKVLSVPRRNSVHGDGDQLVIHGEEPPFTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTLRQVFGKDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGVSYCFFVQAMIFSRKTNQNSPGSSTVCTEQWKSFLGE

• Full Name: coagulation factor III
• Calculated Molecular Weight: 33kDa
• Gene Symbol: Tissue Factor
• Gene ID (NCBI): 14066
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P20352
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.