CoraLite® Plus 488-conjugated Coilin Polyclonal antibody

Coilin Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-10967

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

COIL, p80-coilin, p80 coilin, CLN80

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHEK-293T cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10967 targets Coilin in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1416

Product name: Recombinant human COIL protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 212-576 aa of BC010385

Sequence: ANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRGHPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA

Predict reactive species
Full Name coilin
Calculated Molecular Weight 576 aa, 63 kDa
Observed Molecular Weight 80 kDa
GenBank Accession NumberBC010385
Gene Symbol COIL
Gene ID (NCBI) 8161
RRIDAB_2919012
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP38432
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The nuclear coiled body(CBs) and nuclear structures known as gems contain high concentrations of the survival motor neurons (SMN) protein complex. CBs and gems often colocalize, and communication between them is mediated by COIL. COIL is a component of the CBS which are involved in the function or assembly/disassembly of nucleoplasmic snRNPs. During mitosis, CBs disassemble, coinciding with a mitotic-specific phosphorylation of p80 coilin, and symmetrical dimethylation of the COIL RG box motif is a molecular switch that determines whether the SMN complex forms gems or becomes incorporated into CBs

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Coilin antibody CL488-10967Download protocol
IF protocol for CL Plus 488 Coilin antibody CL488-10967Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...