HRP-conjugated Complement factor H Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HRP-conjugated Complement factor H Polyclonal antibody (HRP-12748)

• 

  WB analysis of human plasma using HRP-12748

  human plasma were subjected to SDS PAGE followed by western blot with HRP-12748 (Complement factor H antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

Complement factor H Polyclonal Antibody for WB

Cat No. HRP-12748

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB

Synonyms

CFH, ARMD4, ARMS1, Factor H, FH

---

Tested Applications

• Positive WB detected in: human plasma

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

HRP-12748 targets Complement factor H in WB applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3482

  Product name: Recombinant human CFH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-349 aa of BC037285

  Sequence: LPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAV

• Full Name: complement factor H
• Calculated Molecular Weight: 1231 aa, 139 kDa
• Observed Molecular Weight: 140-150 kDa
• GenBank Accession Number: BC037285
• Gene Symbol: Complement factor H
• Gene ID (NCBI): 3075
• Conjugate: HRP
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08603
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Complement factor H (CFH) is an abundant plasma glycoprotein that regulates the function of the alternative complement pathway in the fluid phase and on cellular surfaces (PMID: 2963625). Factor H binds to C3b, accelerates the decay of the alternative pathway C3-convertase (C3bBb), and acts as a cofactor for the factor I-mediated proteolytic inactivation of C3b (PMID: 15163532). It plays a critical role in the homeostasis of the complement system in plasma and in the protection of bystander host cells and tissues from damage by complement activation. Abnormalities in factor H have been associated with renal disease (PMID: 18190458).