Use Able AI chat for product recommendations

Connexin 43 Recombinant monoclonal antibody

Connexin 43 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 80543-1-RR
Clone No. 3O6
Publications (2)
Reviews (1)
Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Connexin-43, GJA1, 3O6, CX43, Gap junction alpha 1 protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Connexin 43 in ?

Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue, pig brain tissue, rat cerebellum tissue
Positive IHC detected inmouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse heart tissue
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:125-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

80543-1-RR targets Connexin 43 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25533

Product name: Recombinant human Connexin 43 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 232-382 aa of BC026329

Sequence: FFKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

Predict reactive species
Full Name gap junction protein, alpha 1, 43kDa
Calculated Molecular Weight 43 kDa
Observed Molecular Weight43 kDa
GenBank Accession NumberBC026329
Gene Symbol Connexin-43
Gene ID (NCBI) 2697
RRIDAB_2935545
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP17302
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Connexin 43 (Cx43, also known as gap junction alpha-1), a member of connexin family, plays essential roles in gap junction communication that facilitates direct communication among adjacent cells (PMID: 12270943). Usually, six connexin proteins oligomerize into a hemi-channel or connexon during intercellular channel formation (PMID: 12270943). Mutations of Connexin 43 may cause a series of diseases such as oculodentodigital dysplasia (ODDD), syndactyly 3 (SDTY3), hypoplastic left heart syndrome 1 (HLHS1) and so on (PMID: 18161618, 1472936, 1147490).

Protocols

Product Specific Protocols
IF protocol for Connexin 43 antibody 80543-1-RRDownload protocol
IHC protocol for Connexin 43 antibody 80543-1-RRDownload protocol
WB protocol for Connexin 43 antibody 80543-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Connexin 43 Recombinant monoclonal antibody (3O6), catalog number 80543-1-RR, has 2 citations. They appear in Advanced Materials (IF 29.1), covering myocardial infarction repair via conductive hydrogel patches in rat tissue (IF application), and Frontiers in Bioscience (Landmark Ed) (IF 4.1), addressing conditional immortalization of human cardiac fibroblasts for pro-fibrotic and anti-fibrotic drug screening (IF application). Associated research fields include cardiac tissue engineering and fibrosis biology.

SpeciesApplicationTitle
ratIF

Adv Mater

Injectable Conductive Hydrogel Patch with Spatiotemporally Tailored Asymmetric Adhesion for Myocardial Infarction Repair.

Authors - Yuxin Zhang
humanIF

Front Biosci (Landmark Ed)

Conditional Immortalization of Human Cardiac Fibroblasts for Pro-Fibrotic and Anti-Fibrotic Drug Screening.

Authors - Sushan Wang

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One user reviewed this antibody for immunofluorescence on mouse brain slices at a 1:2000 dilution, giving it a 5-star rating. They reported very nice staining with signal contained in the expected locations, indicating good specificity and performance for their application.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Sama (Verified Customer) (03-26-2026)

Very nice staining - contained where it is expected

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Mouse brain slice
Connexin 43 Antibody Immunofluorescence validation (1:2000 dilution) in Mouse brain slice (Cat no:80543-1-RR)
Loading...
||
New chat

Able™

正在加载,请稍候...