Connexin 43 Recombinant monoclonal antibody

• 

  WB analysis using 80543-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 80543-1-RR (Connexin 43 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse heart using 80543-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 80543-1-RR (Connexin 43 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 80543-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 80543-1-RR (Connexin 43 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 80543-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 80543-1-RR (Connexin 43 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse heart using 80543-1-RR

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using Connexin 43 antibody (80543-1-RR, Clone: 3O6 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse heart using 80543-1-RR

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using Connexin 43 antibody (80543-1-RR, Clone: 3O6 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HeLa using 80543-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using Connexin 43 antibody (80543-1-RR, Clone: 3O6 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 80543-1-RR

  Biolayer interferometry (BLl) kinetic assays of 80543-1-RR against Human Connexin 43 were performed. The affinity constant is 5.19 nM.

Connexin 43 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 80543-1-RR

Clone No.3O6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

Connexin-43, GJA1, 3O6, CX43, Gap junction alpha 1 protein

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue, pig brain tissue, rat cerebellum tissue
• Positive IHC detected in: mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse heart tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

80543-1-RR targets Connexin 43 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25533

  Product name: Recombinant human Connexin 43 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 232-382 aa of BC026329

  Sequence: FFKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

• Full Name: gap junction protein, alpha 1, 43kDa
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC026329
• Gene Symbol: Connexin-43
• Gene ID (NCBI): 2697
• RRID: AB_2935545
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P17302
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Connexin 43 (Cx43, also known as gap junction alpha-1), a member of connexin family, plays essential roles in gap junction communication that facilitates direct communication among adjacent cells (PMID: 12270943). Usually, six connexin proteins oligomerize into a hemi-channel or connexon during intercellular channel formation (PMID: 12270943). Mutations of Connexin 43 may cause a series of diseases such as oculodentodigital dysplasia (ODDD), syndactyly 3 (SDTY3), hypoplastic left heart syndrome 1 (HLHS1) and so on (PMID: 18161618, 1472936, 1147490).