CoraLite® Plus 555-conjugated Connexin 43 Recombinant monoclonal antibody

Connexin 43 Uni-rAb® Recombinant Antibody for IF-P
Cat No. CL555-80543
Clone No.3O6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

IF-P

Connexin-43, GJA1, 3O6, CX43, Gap junction alpha 1 protein

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 555
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse heart tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL555-80543 targets Connexin 43 in IF-P applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25533

Product name: Recombinant human Connexin 43 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 232-382 aa of BC026329

Sequence: FFKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

Predict reactive species
Full Name gap junction protein, alpha 1, 43kDa
Calculated Molecular Weight 43 kDa
Observed Molecular Weight43 kDa
GenBank Accession NumberBC026329
Gene Symbol Connexin-43
Gene ID (NCBI) 2697
Conjugate CoraLite® Plus 555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths554 nm / 570 nm
Excitation LaserGreen Laser (532 nm), Yellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP17302
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Connexin 43 (Cx43, also known as gap junction alpha-1), a member of connexin family, plays essential roles in gap junction communication that facilitates direct communication among adjacent cells (PMID: 12270943). Usually, six connexin proteins oligomerize into a hemi-channel or connexon during intercellular channel formation (PMID: 12270943). Mutations of Connexin 43 may cause a series of diseases such as oculodentodigital dysplasia (ODDD), syndactyly 3 (SDTY3), hypoplastic left heart syndrome 1 (HLHS1) and so on (PMID: 18161618, 1472936, 1147490).

Protocols

Product Specific Protocols
IF protocol for CL Plus 555 Connexin 43 antibody CL555-80543Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...