Tested Applications
| Positive WB detected in | HT-29 cells, HeLa cells, Jurkat cells, K-562 cells, C6 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human skin cancer tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, HT-29 cells |
| Positive FC (Intra) detected in | Ramos cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28603-1-AP targets Cyclin B1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human, mouse, rat, pig, canine, chicken, bovine, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29426 Product name: Recombinant human CCNB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-140 aa of BC006510 Sequence: MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEE Predict reactive species |
| Full Name | cyclin B1 |
| Calculated Molecular Weight | 48 kDa |
| Observed Molecular Weight | 55-60 kDa |
| GenBank Accession Number | BC006510 |
| Gene Symbol | Cyclin B1 |
| Gene ID (NCBI) | 891 |
| RRID | AB_2881179 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P14635 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cyclin B1 is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase of the cell cycle. The different transcripts result from the use of alternate transcription initiation sites. The antibody is specific to CCNB1. We got a 55-60 kDa band in western blotting maybe due to phosphorylation.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Cyclin B1 antibody 28603-1-AP | Download protocol |
| IF protocol for Cyclin B1 antibody 28603-1-AP | Download protocol |
| IHC protocol for Cyclin B1 antibody 28603-1-AP | Download protocol |
| IP protocol for Cyclin B1 antibody 28603-1-AP | Download protocol |
| WB protocol for Cyclin B1 antibody 28603-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Cyclin B1 Polyclonal antibody (Cat# 28603-1-AP) has 112 citations. These appear in journals including Nature Cell Biology, Nature Communications, Advanced Science, Cancer Letters, Cell Death & Disease, International Journal of Biological Sciences, Journal of Translational Medicine, Scientific Reports, Oncogenesis, and FASEB Journal. Research fields span oncology (hepatocellular, lung, ovarian, glioblastoma, colorectal, bladder, and breast cancers), cell cycle regulation, rheumatoid arthritis, reproductive biology (oocyte maturation, PCOS), fibrosis, and viral replication, primarily using Western blot, IHC, and IF applications.
| Species | Application | Title |
|---|---|---|
Nat Cell Biol O-GlcNAcylation determines the translational regulation and phase separation of YTHDF proteins | ||
Exp Mol Med Genetic and pharmaceutical manipulation of H3K9 methyltransferase Suv39h1 promotes liver regeneration by unleashing HMGB2 transcription. | ||
Acta Pharm Sin B Design, synthesis, and antitumor activity of novel thioheterocyclic nucleoside derivatives by suppressing the c-MYC pathway | ||
Adv Sci (Weinh) A Glycoproteome Data Mining Strategy for Characterizing Structural Features of Altered Glycans with Thymic Involution | ||
Adv Sci (Weinh) Pericentrosomal Redistribution of the Endoplasmic Reticulum Ensures Organelle Symmetric Inheritance and Mitotic Progression |
