Cyclin H Monoclonal antibody, PBS Only

• 

  WB analysis using 67065-1-Ig (same clone as 67065-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67065-1-Ig (Cyclin H antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67065-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67065-1-Ig (same clone as 67065-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67065-1-Ig (Cyclin H antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67065-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67065-1-Ig (same clone as 67065-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67065-1-Ig (Cyclin H antibody) at dilution of 1:800 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67065-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67065-1-Ig (same clone as 67065-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67065-1-Ig (Cyclin H antibody) at dilution of 1:800 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67065-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 67065-1-Ig (same clone as 67065-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using Cyclin H antibody (67065-1-Ig, Clone: 2C5G11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67065-1-PBS in a different storage buffer formulation.

• 

  FC experiment of PC-3 using 67065-1-Ig (same clone as 67065-1-PBS)

  1X10^6 PC-3 cells were intracellularly stained with 0.4 ug Anti-Human Cyclin H (67065-1-Ig, Clone:2C5G11) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (C1.18.4) (65208-1-Ig, Clone: C1.18.4) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 67065-1-PBS in a different storage buffer formulation.

Cyclin H Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 67065-1-PBS

Clone No.2C5G11

Host / Isotype

Mouse / IgG2a

Reactivity

rat, mouse, human

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

CCNH, 2C5G11, p34, MO15-associated protein, MO15 associated protein

---

Product Information

67065-1-PBS targets Cyclin H in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with rat, mouse, human samples.

• Tested Reactivity: rat, mouse, human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28556

  Product name: Recombinant human CCNH protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-323 aa of BC005280

  Sequence: MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL

• Full Name: cyclin H
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC005280
• Gene Symbol: Cyclin H
• Gene ID (NCBI): 902
• RRID: AB_2882375
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P51946
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.