Cyclin H Monoclonal antibody

• 

  WB analysis using 67065-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67065-1-Ig (Cyclin H antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67065-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67065-1-Ig (Cyclin H antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 67065-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67065-1-Ig (Cyclin H antibody) at dilution of 1:800 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 67065-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67065-1-Ig (Cyclin H antibody) at dilution of 1:800 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of PC-3 using 67065-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using Cyclin H antibody (67065-1-Ig, Clone: 2C5G11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• 

  FC experiment of PC-3 using 67065-1-Ig

  1X10^6 PC-3 cells were intracellularly stained with 0.4 ug Anti-Human Cyclin H (67065-1-Ig, Clone:2C5G11) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (C1.18.4) (65208-1-Ig, Clone: C1.18.4) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

Cyclin H Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 67065-1-Ig

Clone No.2C5G11

Publications(2)

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

CCNH, 2C5G11, p34, MO15-associated protein, MO15 associated protein

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, HSC-T6 cells, MCF-7 cells, NCCIT cells, HT-1080 cells, LNCaP cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-3 cells
• Positive FC (Intra) detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

67065-1-Ig targets Cyclin H in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28556

  Product name: Recombinant human CCNH protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-323 aa of BC005280

  Sequence: MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL

• Full Name: cyclin H
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC005280
• Gene Symbol: Cyclin H
• Gene ID (NCBI): 902
• RRID: AB_2882375
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P51946
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Genes Dev; TRF1 uses a noncanonical function of TFIIH to promote telomere replication; Authors - Zhe Yang
mouse	WB	Adv Sci (Weinh); m6A Reader hnRNPA2B1 Modulates Late Pachytene Progression in Male Meiosis Through Post-Transcriptional Control; Authors - Lisha Yin