• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Cytokeratin 14 Recombinant monoclonal antibody

Cytokeratin 14 Uni-rAb® Recombinant Antibody for IF-P
Cat No. CL488-82824
Clone No.1L19

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

KRT14, 1L19, CK 14, CK14, CK-14

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse skin tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82824 targets Cytokeratin 14 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag17559

Product name: Recombinant human KRT14 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 426-472 aa of BC002690

Sequence: LSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN

Predict reactive species
Full Name keratin 14
Calculated Molecular Weight 472 aa, 52 kDa
Observed Molecular Weight52 kDa
GenBank Accession NumberBC002690
Gene Symbol Cytokeratin 14
Gene ID (NCBI) 3861
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02533
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Cytokeratin 14, one of about 20 different cytokeratin isotypes of human cells, is the intermediate filament protein characteristic of epithelial cells. Cytokeratin 14 is expressed in the basal compartment of all stratified squamous epithelia. In various kinds of human tumors, the appearance and increasing expression of Cytokeratin 14 were strikingly associated with higher grade and stage of carcinoma, with varying degrees of unfavorable prognosis. In lung squamous cell carcinoma(LSCC), Cytokeratin 14 was expressed in the tumor cell nests showing stromal invasion with fibrosis and lymph node metastases, indicating that Cytokeratin 14 involved in proliferation and metastasis of LSCC. Cytokeratin 14 expression is sometimes used in diagnosis of myoepithelioma and intraductal vs. invasive ductal carcinoma of the breast.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Cytokeratin 14 antibody CL488-82824Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...