CoraLite® Plus 488-conjugated Cytokeratin 15 Monoclonal antibody

• 

  IF Staining of HeLa using CL488-60247

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 Cytokeratin 15 antibody (CL488-60247, Clone: 6B4F8 ) at dilution of 1:200, CL594-Phalloidin (red).

Cytokeratin 15 Monoclonal Antibody for IF/ICC

Cat No. CL488-60247

Clone No.6B4F8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

KRT15, Cytokeratin-15 , Cytokeratin,Keratin, CK-15, CK15

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60247 targets Cytokeratin 15 in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0185

  Product name: Recombinant human KRT15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 238-450 aa of BC002641

  Sequence: AYLKKNHEEEMKEFSSQLAGQVNVEMDAAPGVDLTRVLAEMREQYEAMAEKNRRDVEAWFFSKTEELNKEVASNTEMIQTSKTEITDLRRTMQELEIELQSQLSMKAGLENSLAETECRYATQLQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVS

• Full Name: keratin 15
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC002641
• Gene Symbol: KRT15
• Gene ID (NCBI): 3866
• RRID: AB_3672865
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P19012
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells. Keratin expression is highly regulated, tissue specific, and varies according to cell-state. Type I keratins consist of acidic, low molecular weight proteins with MW ranging from 40 kDa (KRT19) to 64 kDa (KRT9). Type 2 keratins consist of basic or neutral, high molecular weight proteins with MW from 52 kDa (KRT8) to 67 kDa (KRT18). Keratin 15 is a type I cytokeratin. It is found in some progenitor basal cells within complex epithelia.