DAAM2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DAAM2 Polyclonal antibody, PBS Only (25206-1-PBS)

• 

  WB analysis of mouse brain using 25206-1-AP (same clone as 25206-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25206-1-AP (DAAM2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25206-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 25206-1-AP (same clone as 25206-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 25206-1-AP (DAAM2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25206-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Transfected HEK-293 using 25206-1-AP (same clone as 25206-1-PBS)

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 25206-1-AP (DAAM2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25206-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 25206-1-AP (same clone as 25206-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 25206-1-AP (DAAM2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25206-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 25206-1-AP (same clone as 25206-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 25206-1-AP (DAAM2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25206-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 25206-1-AP (same clone as 25206-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 25206-1-AP (DAAM2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25206-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 25206-1-AP (same clone as 25206-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 25206-1-AP (DAAM2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25206-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 25206-1-AP (same clone as 25206-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using DAAM2 antibody (25206-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25206-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DAAM2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 25206-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

25206-1-PBS targets DAAM2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18955

  Product name: Recombinant human DAAM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 4-55 aa of BC128388

  Sequence: RKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAEL

• Full Name: dishevelled associated activator of morphogenesis 2
• Calculated Molecular Weight: 1068 aa, 123 kDa
• Observed Molecular Weight: 100-130 kDa
• GenBank Accession Number: BC128388
• Gene Symbol: DAAM2
• Gene ID (NCBI): 23500
• RRID: AB_2879959
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86T65
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.