DAPK1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67815-1-Ig (same clone as 67815-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67815-1-Ig (DAPK1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control. This data was developed using the same antibody clone with 67815-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67815-1-Ig (same clone as 67815-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67815-1-Ig (DAPK1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67815-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 67815-1-Ig (same clone as 67815-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67815-1-Ig (DAPK1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67815-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 67815-1-Ig (same clone as 67815-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 67815-1-Ig (DAPK1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67815-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skin using 67815-1-Ig (same clone as 67815-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 67815-1-Ig (DAPK1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67815-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse small intestine using 67815-1-Ig (same clone as 67815-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 67815-1-Ig (DAPK1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67815-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat small intestine using 67815-1-Ig (same clone as 67815-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 67815-1-Ig (DAPK1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67815-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67815-1-Ig (same clone as 67815-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67815-1-Ig (DAPK1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67815-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human breast cancer using 67815-1-Ig (same clone as 67815-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using DAPK1 antibody (67815-1-Ig, Clone: 1E2F9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67815-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HT-1376 using 67815-1-Ig (same clone as 67815-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HT-1376 cells using DAPK1 antibody (67815-1-Ig, Clone: 1E2F9 ) at dilution of 1:1000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ). This data was developed using the same antibody clone with 67815-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HCT 116 using 67815-1-Ig (same clone as 67815-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HCT 116 cells using DAPK1 antibody (67815-1-Ig, Clone: 1E2F9 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67815-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HCT 116 using 67815-1-Ig (same clone as 67815-1-PBS)

  1X10^6 HCT 116 cells were intracellularly stained with 0.4 ug Anti-Human DAPK1 (67815-1-Ig, Clone:1E2F9) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 67815-1-PBS in a different storage buffer formulation.

DAPK1 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA

Cat No. 67815-1-PBS

Clone No.1E2F9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA

Synonyms

1E2F9, DAP kinase 1, DAPK, Death-associated protein kinase 1, EC:2.7.11.1

---

Product Information

67815-1-PBS targets DAPK1 in WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29838

  Product name: Recombinant human DAPK1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 638-798 aa of BC113660

  Sequence: ALTTDGKTAEDLARSEQHEHVAGLLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKTTLVESLKCGLLRSFFRRRRPRLSSTNSSRFPPSPLASKPTVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAPTHHPHCSADDQSTKAIDI

• Full Name: death-associated protein kinase 1
• Calculated Molecular Weight: 1430 aa, 160 kDa
• Observed Molecular Weight: 160 kDa
• GenBank Accession Number: BC113660
• Gene Symbol: DAPK1
• Gene ID (NCBI): 1612
• RRID: AB_2918578
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P53355
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DAPK1(Death-associated protein kinase 1) is a stress-activated tumor suppressor protein that plays a role in both proapoptotic or antiapoptotic signal transduction pathways. Loss of DAPK1 expression is associated with a selective advantage fortumor cells to resist apoptotic stimuli, allowing them to separate from the original tumor; from this point of view, DAPK1 could be considered a tumor metastases inhibitor gene(PMID:17319784).