Tested Applications
| Positive WB detected in | LNCaP cells, A549 cells, HeLa cells, HepG2 cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells |
| Positive IHC detected in | human breast cancer tissue, human placenta tissue, human stomach cancer tissue, mouse skin tissue, mouse small intestine tissue, rat small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human breast cancer tissue |
| Positive IF/ICC detected in | HCT 116 cells, HT-1376 cells |
| Positive FC (Intra) detected in | HCT 116 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67815-1-Ig targets DAPK1 in WB, IHC, IF/ICC, IF-P, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29838 Product name: Recombinant human DAPK1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 638-798 aa of BC113660 Sequence: ALTTDGKTAEDLARSEQHEHVAGLLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKTTLVESLKCGLLRSFFRRRRPRLSSTNSSRFPPSPLASKPTVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAPTHHPHCSADDQSTKAIDI Predict reactive species |
| Full Name | death-associated protein kinase 1 |
| Calculated Molecular Weight | 1430 aa, 160 kDa |
| Observed Molecular Weight | 160 kDa |
| GenBank Accession Number | BC113660 |
| Gene Symbol | DAPK1 |
| Gene ID (NCBI) | 1612 |
| RRID | AB_2918578 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P53355 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DAPK1(Death-associated protein kinase 1) is a stress-activated tumor suppressor protein that plays a role in both proapoptotic or antiapoptotic signal transduction pathways. Loss of DAPK1 expression is associated with a selective advantage fortumor cells to resist apoptotic stimuli, allowing them to separate from the original tumor; from this point of view, DAPK1 could be considered a tumor metastases inhibitor gene(PMID:17319784).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for DAPK1 antibody 67815-1-Ig | Download protocol |
| IF protocol for DAPK1 antibody 67815-1-Ig | Download protocol |
| IHC protocol for DAPK1 antibody 67815-1-Ig | Download protocol |
| WB protocol for DAPK1 antibody 67815-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The DAPK1 Monoclonal antibody (Cat# 67815-1-Ig) has 7 total citations. These appear in journals including Theranostics, Advanced Science, Cell Death & Differentiation, Cell Communication & Signaling, Chinese Journal of Natural Medicines, Biochemical and Biophysical Research Communications, and Oncogene. Research fields span epilepsy treatment, diabetic encephalopathy, Parkinson's disease, subarachnoid hemorrhage, diabetic kidney disease, renal tubular apoptosis, and triple-negative breast cancer, reflecting applications in neurology, metabolism, and oncology.
| Species | Application | Title |
|---|---|---|
Theranostics Macrophage membrane‒biomimetic nanoparticles target inflammatory microenvironment for epilepsy treatment | ||
Adv Sci (Weinh) Epigenetic Regulation of DAPK1 and Netrin-1 Drives Diabetic Encephalopathy | ||
Cell Commun Signal P38-DAPK1 axis regulated LC3-associated phagocytosis (LAP) of microglia in an in vitro subarachnoid hemorrhage model | ||
Chin J Nat Med Morin enhances the renoprotective effects of Empagliflozin in diabetic kidney disease via targeting ATF6-DAPK1 signaling. | ||
Biochem Biophys Res Commun KLHL20 alleviates high glucose-induced mitochondrial apoptosis in renal tubular cells by targeting DAPK1 for ubiquitination and degradation. |
